KEGG   Burkholderia sp. CCGE1003: BC1003_0802Help
Entry
BC1003_0802       CDS       T01314                                 

Definition
phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain II
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
bgf  Burkholderia sp. CCGE1003
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bgf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BC1003_0802
   00030 Pentose phosphate pathway
    BC1003_0802
   00051 Fructose and mannose metabolism
    BC1003_0802
   00052 Galactose metabolism
    BC1003_0802
   00500 Starch and sucrose metabolism
    BC1003_0802
   00520 Amino sugar and nucleotide sugar metabolism
    BC1003_0802
  Nucleotide metabolism
   00230 Purine metabolism
    BC1003_0802
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BC1003_0802
Enzymes [BR:bgf01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     BC1003_0802
    5.4.2.8  phosphomannomutase
     BC1003_0802
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:914531..915925
Genome map
AA seq 464 aa AA seqDB search
MISKSIFKAYDIRGVIGKTLDADAARSIGRAFGSEVRAQGGDAVVVARDGRLSGPELIQA
LSDGLRAAGVDVVNVGMVPTPVGYFAASVPLALEGGERRVDSCIVVTGSHNPPDYNGFKM
VLRGSAIYGEQILALHQRIVDENFSTGSGTYVEYDIADDYLARIAGDVKLARPIKIVVDA
GNGVAGGLAPRLFKKLGCELVELFTEIDGNFPNHHPDPAHPENLQDVIRALKETDAEIGF
AFDGDGDRLGVVTKDGQIIYPDRQLMLFAEEVLSRNKGAQIIYDVKCTRNLAKWVKDKGG
EPLMWKTGHSLVKAKLRETGAPLAGEMSGHVFFKDRWYGFDDGLYTGARLLEILTRVEDP
SKLLNSLPNSNSTPELQLKLEEGENFELIARLQKNAQFTGADNVVTIDGLRVEYPDGFGL
ARSSNTTPVVVMRFEADNDAALKRIQEDFRRVILAEKADAKLPF
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgatctccaaatccattttcaaggcatatgacattcgcggtgtgatcggcaagacgctc
gacgccgacgcagcgcggtcgattggccgcgcattcggtagcgaagtgcgtgcgcaaggc
ggcgacgccgtggtggtcgcgcgcgacggtcggctgtcgggtccggagttgatccaggca
ttgtcggacggcctgcgtgcggccggtgtcgacgtggtcaacgtgggcatggtgcccacg
ccggtcggttacttcgcggcaagtgtgccgctcgcgctggaaggcggcgaacgccgcgtc
gactcgtgcatcgtcgtgacgggtagtcataatccgccggattacaacggcttcaagatg
gtgctgcgcggctccgcgatttacggcgagcagatcctcgcactgcatcagcgcatcgtc
gacgaaaacttctccaccggcagcggtacctatgtggagtacgacattgcggatgattac
cttgcccgcattgccggcgacgtcaagctcgcacgtccgatcaagatcgtggtggacgcg
ggcaacggcgtcgcgggcggcctcgccccccggctcttcaagaagcttggctgcgaactc
gtcgaactgtttacggagatcgacggcaacttcccgaaccatcacccggacccggctcat
ccggaaaaccttcaggacgtgattcgcgcgctgaaggaaacggacgcggaaatcggcttt
gcattcgacggcgacggcgaccgtctcggcgtcgtcaccaaagacggccagatcatttat
ccggaccgccaactgatgctgttcgccgaagaagtcctgtcgcgcaacaagggcgcgcag
atcatttacgacgtgaagtgcacgcgcaatctcgcgaagtgggtgaaggacaagggcggc
gagccgctcatgtggaagacgggccactcgctcgtcaaggcgaagctgcgcgaaaccggc
gcgcctttggcgggcgaaatgagcggccacgtgttcttcaaggaccgctggtacggtttc
gacgacggtctgtacaccggcgcacgtctgctcgaaatcctcacgcgtgtggaagacccg
agcaagctgctgaactcgctgcccaactccaactccacgcccgagctgcaactgaagctt
gaggaaggcgagaacttcgaactgatcgcgcgtctgcagaaaaacgcccagttcaccggc
gcggacaacgtggtgacgatcgacggcttgcgcgtcgagtatccggacggcttcggcctt
gcgcgctcgtcgaacaccacgccggttgtcgtcatgcgtttcgaagcggataacgacgcg
gcgctcaaacgcattcaggaagacttccgccgcgtgattctggccgaaaaggcggacgcg
aagttgccgttctag

DBGET integrated database retrieval system