KEGG   Burkholderia sp. CCGE1003: BC1003_0827Help
Entry
BC1003_0827       CDS       T01314                                 

Definition
(GenBank) Protein-L-isoaspartate(D-aspartate) O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
bgf  Burkholderia sp. CCGE1003
Brite
Enzymes [BR:bgf01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     BC1003_0827
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_25 Methyltransf_31 Methyltransf_11 MTS Methyltransf_23 RrnaAD PrmA Methyltransf_12 Ubie_methyltran Met_10 Methyltransf_18 Methyltransf_32 DUF938 Methyltransf_3 UPF0146 ADH_zinc_N Methyltransf_16 Methyltransf_24 tRNA_U5-meth_tr Methyltransf_4 Methyltransf_9 Methyltr_RsmB-F MethyltransfD12 MetW CMAS
Motif
Other DBs
NCBI-ProteinID: ADN56811
JGI: BC1003_0827
UniProt: E1TAV6
Position
1:complement(939613..940266)
Genome map
AA seq 217 aa AA seqDB search
MNIEQARFNMIEQQIRPWEVLDQDVLNLLSIVKRENFVPAAYRELAFADFEVPLPAGQHM
LAPRVEARVLQELAVKKHESVLEIGAGSGYMAALLAHRAQHVLTVDIEPELAELAKANLI
GNGVLNVEVATGDAARGWAAAAPYDVICVSGGLPVLPQEMLEHLKIGGRLAAFVGTAPVM
KAQVITRIDEKQYRIADVFETYVEPLVNAVQPPRFKF
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcgagcaagcgcgtttcaacatgatcgaacagcagatccgcccctgggaagtg
ctcgaccaggacgtgctgaatctgctgtcgatcgtcaagcgtgaaaacttcgtccccgcc
gcttaccgcgaactggctttcgccgacttcgaagtgccgctgccggccggccagcacatg
ctggcgccgcgcgtggaagcgcgcgtgctgcaggaactggcggtgaagaaacacgaaagc
gtgctggaaatcggcgccggctccggttatatggcggcgctgctcgcgcatcgcgcgcaa
cacgtgctgaccgtcgacatcgaacccgaactcgctgaactggccaaggccaacctgatc
ggcaacggcgtgctgaacgtggaagtcgcaacgggcgacgccgcacgcggctgggccgcc
gccgctccgtacgacgtgatctgcgtgtcgggcgggctgccggtgctgccgcaggaaatg
ctcgagcatctgaagattggcggccgtctggctgcgttcgtcggcacggcgccggtcatg
aaggcgcaggtcatcacgcgtatcgacgaaaagcagtaccgcattgccgacgtgttcgag
acgtatgtcgagccgctcgtcaacgccgtgcagccgccgcgcttcaagttctga

DBGET integrated database retrieval system