KEGG   Burkholderia sp. CCGE1003: BC1003_0899Help
Entry
BC1003_0899       CDS       T01314                                 

Definition
agmatinase
Orthology
K12255  
guanidinobutyrase [EC:3.5.3.7]
Organism
bgf  Burkholderia sp. CCGE1003
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bgf00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BC1003_0899
Enzymes [BR:bgf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.7  guanidinobutyrase
     BC1003_0899
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1022033..1023025
Genome map
AA seq 330 aa AA seqDB search
MNTSSFISPEAGERPQPLSGNAMPRCGGIATMMRLPNVGSAAGFDACFVGVPFDLGTSNR
TGARFGPRQIRSESVLLRPYNMATRAAPFDSLRVADLGDVAINPYNLHDSIARIETAYDE
ILQHDCKPVTLGGDHTIALPILRAIHRKHGKVGLIHVDAHADVNDTMMGEKIAHGTPFRR
AVEEGLLDCERVVQIGLRGTGYAAEDFDWCRDQGFEVVQAEACWNQSLAPLMARVRERMG
NAPVYLTFDIDGIDPAFAPGTGTPEIAGLTVPQALEIIRGARGLNIVGCDLVEVAPPYDP
FGTTALLGANLAFELLCVLPGVEYRTSVRL
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaatacttcctctttcatttcccccgaagccggcgagcggccgcaaccgctctcgggc
aatgcaatgccgcgctgcggcggcattgcgacgatgatgcgcttgccgaatgtcggctcc
gctgcgggattcgatgcctgtttcgtcggcgtgccgttcgatctgggcacctccaaccgc
acgggcgcgcgcttcgggccgcgccagattcgcagcgagtcggtgctgctgcgcccctac
aacatggcgacgcgcgcagcgccgttcgattcgctgcgcgtggccgacctcggcgacgtg
gccatcaacccgtacaacctgcatgactcgattgcgcgaatcgaaaccgcgtatgacgag
attctccagcacgattgcaagccggtcacgttaggcggcgatcacacgatagcgttgccg
atcctgcgcgcgattcatcgcaagcacggcaaagtgggactgattcacgtcgacgcgcat
gccgacgtcaatgacacgatgatgggagagaaaatcgcccacggcacgccgtttcgtcgc
gcggtggaggagggcttgctcgactgtgagcgcgtcgtgcagatcggtctgcgcggcacc
ggctacgctgccgaagacttcgactggtgtcgcgatcagggcttcgaggtcgtgcaggcc
gaagcctgctggaaccagtcgctcgcaccgctgatggcgcgcgtgcgcgagcgcatggga
aatgcgccggtctatctgacattcgacatcgacgggatcgatcccgctttcgcgcctggc
accggcacgccggaaattgccggactgacggtgccgcaggcgctcgaaatcattcgcggc
gcgcgcgggttgaacatcgtcgggtgcgatctggtggaggtcgcgccgccgtacgatccg
ttcggcaccacggcgctgcttggcgccaacctggcgttcgagttgctgtgcgtgctgccg
ggcgtcgaatatcggacgtctgtacgcctgtag

DBGET integrated database retrieval system