KEGG   Burkholderia sp. CCGE1003: BC1003_0919Help
Entry
BC1003_0919       CDS       T01314                                 

Definition
hypothetical protein
Orthology
K13543  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
bgf  Burkholderia sp. CCGE1003
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bgf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BC1003_0919
Enzymes [BR:bgf01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     BC1003_0919
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     BC1003_0919
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1046768..1048789
Genome map
AA seq 673 aa AA seqDB search
MAADTPRNASSSGAGQAAFTVVITRPAGQSSELIARLAAAGVATLDFPLIDIAPVADDTP
LRAALGSLERYALVVFVSPNAIDHAFAKSGAIWPHALPLGVVGPGSVRALARHGVSAPAY
QVISPAAGVDDENGRFDSEGLYAAIEAALGETGLEGKRVLIVRGDGGREWLADRLREAGA
QVETVAAYRRLVPEPSIGAWARVHQLLAGEAHAWLLTSSEGVRNLHELAHEHLTADEIAQ
LKRALLVTPHPRIAQTARALGFDRITVSGAGDERIAQALLAALPTVVQPVPSNPAHSPAQ
SRMTETNASTNASPQPAATASLPPNQPFTPYEAQKRRSASGPLLWFVVVVLACAAGVGGY
ALNRKLERTEQQIAQRQQANDTQTNELRIKTEQALATVRQSDSQVAQLEGKLADAQAAQQ
ALQQQYADLARNRDDWTLAEVGQMLSAASQQLQLTGNTQLALFALQSADTRLAASDSAQA
VAVRKAIAQDIDKLKAAPSTDLTGLAIKLDNAVDQVDSLPLSGEAPIAHATPRAATWADT
AKVAAATGEPRWKVWWREVTSGIGQQLTSLVQVRRIDHADAMMVAPDQGYFVRENVKLRL
LSARLALLSRNETTLKSDLQAAQSALTRYFDASSKKTQNVVDLVKQVEAGSAAVELPNLN
TSLQAVNQYRSRG
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atggccgccgacactccacgcaacgcatcatcgtcgggcgccggtcaggcggctttcacg
gtcgtcattacgcgaccggccggtcagtcgagcgagttgatcgcgcggcttgccgcagcc
ggcgtcgcgacgctcgactttccgctcatcgacatagcgccggttgcggacgacacgccg
ctgcgcgccgcgctcggttcgctggagcgttacgcgctcgtcgtattcgtgtcgcccaat
gcgatcgaccacgcgtttgcgaagagcggcgcgatctggccgcatgcgttgccgctcggc
gtggtcgggccgggcagtgtgcgtgcgctcgcgcgacacggcgtgagtgcgccggcgtac
caggtcatcagcccggcagcgggcgtggatgacgagaacggtcgcttcgattccgaggga
ctctacgccgcgatcgaggccgcgctaggcgagacgggcctcgaaggcaagcgtgtgctg
atcgtgcgcggcgacggcggccgcgagtggcttgcggatcgtctgcgcgaagcgggcgcg
caggtcgagacggtcgctgcttaccggcgcctcgtgcccgaaccgtctatcggggcgtgg
gcgcgcgttcatcaactgctggcgggcgaagcgcatgcatggctgctcacgagttccgag
ggcgtgcgcaatctgcacgaactcgcgcacgaacatctgaccgccgacgaaatcgcgcag
ctcaagcgcgcgctgctcgtcacgccgcatccccgtatcgcgcagaccgcgcgggcattg
ggttttgataggattacggtgtccggcgcgggcgacgagcgcatcgcccaagccctgctc
gccgccctgccgaccgtagttcaaccggtaccgtccaatccggctcattcaccggctcaa
tcacgcatgactgaaacgaacgcatccacgaacgcttcaccccagccggccgcgactgcc
agcttgccgccgaaccaacccttcacgccctacgaagcgcagaagcgccgcagcgcgagc
ggaccgctgctgtggtttgtcgtcgtggttctggcttgcgccgcgggcgtgggcgggtat
gcactgaatcgcaagctggagcgcaccgaacagcagatcgcgcagcgccagcaggcgaac
gacacacaaaccaacgagttgcgcatcaagaccgagcaggcgctcgccacggtgcgtcag
tccgactcgcaggtcgcgcaactggaaggcaagctcgccgatgcacaggccgcgcaacag
gcgctgcaacagcaatacgccgatctggcgcgcaatcgcgacgactggacactcgccgag
gtcgggcaaatgctctctgccgcgagtcagcaattgcaattgaccggcaacacacagctt
gcgcttttcgcgctgcaaagcgccgacacgcggctcgcggcgtccgatagcgcgcaggcg
gtcgcggtgcgcaaggccatcgcgcaggacatcgacaagctgaaggcggcgccttccacc
gacctcacaggtcttgccatcaagctcgacaacgcggtcgatcaggtagacagcctgccg
ctctcgggcgaggcgcccattgcacatgccacgccccgcgcggccacctgggccgacacg
gcgaaggtcgcggcggccaccggcgagccgcgctggaaagtgtggtggcgcgaggtgacg
agcggcatcggccagcagttgacgagcctcgtgcaggtgcgccgcatcgaccatgccgat
gcgatgatggtcgcgcccgatcagggctatttcgtgcgtgagaacgtgaagctgcggctg
ttgtcggcacggctcgcgctgctgtcgcgcaacgagaccacgctcaagtccgacttgcag
gcggcgcaaagcgcgctgacgcgttatttcgatgcatcgtcgaagaaaacgcagaacgtg
gtcgatctcgtcaagcaggtcgaagccggctcagccgcagtggagttgccgaatctgaac
accagtctgcaagcggtcaatcaataccggagccgaggttaa

DBGET integrated database retrieval system