KEGG   Burkholderia sp. CCGE1003: BC1003_1254Help
Entry
BC1003_1254       CDS       T01314                                 

Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
bgf  Burkholderia sp. CCGE1003
Pathway
bgf00620  Pyruvate metabolism
bgf00630  Glyoxylate and dicarboxylate metabolism
bgf01100  Metabolic pathways
bgf01110  Biosynthesis of secondary metabolites
bgf01120  Microbial metabolism in diverse environments
bgf01200  Carbon metabolism
Module
bgf_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bgf00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BC1003_1254
   00630 Glyoxylate and dicarboxylate metabolism
    BC1003_1254
Enzymes [BR:bgf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     BC1003_1254
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: ADN57231
JGI: BC1003_1254
UniProt: E1T4S5
Position
1:complement(1445132..1446727)
Genome map
AA seq 531 aa AA seqDB search
MANSLSSLPQGMEITGEIKPGYEAILTREALELVAALHRTFEPRRQQLLQARAERTKRLD
AGERPDFLAETKSVREGNWTIAPLPQDLQCRRVEITGPVERKMIINALNSGADSYMTDFE
DSNAPSWDNQITGHINLKDAVRRTISLEQNGKRYKLNDKVATLIVRPRGWHLDEKHVKVD
GKRVSGGIFDFALFMMHNAKELVARGSGPYFYLPKMESHLEARLWNDIFVAAQEAVGVPR
GTIRATVLIETILAAFEMDEILYELREHSSGLNAGRWDYIFSAIKKFKSDRDFCLADRSQ
ITMTAPFMRAYALLLLKTCHRRNAPAIGGMSALIPIKNDPVANDKAMAGVRSDKARDAGD
GYDGGWVAHPGLVPIAMEEFVKVLGDKPNQIGKQREDVLVTATDLLDFRPEAPITEAGLR
NNINVGIHYLGSWLAGNGCVPIHNLMEDAATAEISRSQVWQWIRSPKGTLDDGRKVSAEL
VRELAVQELDKVKQTVGGDTKPYERAAQIFEQMSTSEQFTDFLTLPLYEEI
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atggcgaattcgctgtcatcgctgccacagggcatggaaatcaccggcgagatcaagccg
ggctacgaagcgattctcacgcgcgaggcgctcgaactcgtcgctgcgctacatcgcacg
ttcgagccgcgccgtcagcagttgctgcaggcgcgcgccgagcgcacgaaacgtctggac
gcgggtgagcgccccgatttcctcgccgagacgaagagtgtgcgcgaaggtaactggacc
attgcgccactgccgcaagacctgcaatgccgccgcgtggaaatcaccggtccggtcgag
cgcaagatgattatcaacgcgctgaattcgggcgcggattcgtacatgaccgacttcgag
gattcgaatgcgccgagctgggacaaccagatcacgggccatatcaatctgaaggacgcc
gtgcgccgcacgatttcgctcgagcagaacggcaagcgctacaagctgaacgacaaggtc
gccacgctgatcgtgcgcccgcgcggctggcatctcgacgagaaacacgtgaaggtggac
ggcaagcgcgtgtcgggcggcattttcgatttcgcgctcttcatgatgcacaacgcgaag
gaactggtcgcgcgcggctcgggcccgtacttctatcttccgaagatggagagccatctg
gaggcgcgtctgtggaatgacattttcgtcgccgcgcaggaagcggtcggcgtgccgcgc
ggcacgattcgcgcgaccgtgctgatcgaaacgattctcgccgcgttcgaaatggacgag
attctgtacgagctgcgcgagcatagttcggggctcaacgcgggccgctgggactacatc
ttttcagcaatcaagaagttcaagtccgaccgcgacttctgcctcgcggatcgctcgcaa
atcacgatgacggcgcccttcatgcgcgcctatgcgctgttgctgctcaaaacttgccat
cgccgcaacgcaccggccattggcggcatgagcgcgctgattccgatcaagaacgatccg
gtcgcgaacgacaaggcgatggccggcgtgcgctctgacaaggcgcgcgatgccggcgac
ggttacgacggcggctgggtcgcgcacccggggctcgtgccgatcgcaatggaagaattc
gtcaaggtgctcggcgacaagcccaatcagatcggcaagcagcgcgaggacgtgctcgtc
actgcgacggatctgctcgacttccgtccggaggcgccgatcacggaggcaggtctgcgc
aacaacatcaacgtcggcattcactacctgggctcgtggctcgccggcaacggttgcgtg
ccgatccacaatctgatggaagatgccgcgacggccgagatttcgcgctcacaagtctgg
caatggattcgctcgcccaagggcacgctcgacgacggccgcaaggtgagcgccgaactg
gtgcgcgaactcgccgtgcaggagctcgacaaggtcaagcagacggtgggcggcgatacg
aagccctatgagcgcgccgcgcagatcttcgagcagatgtcgacgtcggaacagttcacc
gacttcctgacgctgccgctctacgaagagatctga

DBGET integrated database retrieval system