KEGG   Burkholderia sp. CCGE1003: BC1003_1254Help
Entry
BC1003_1254       CDS       T01314                                 

Definition
(RefSeq) malate synthase A (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
bgf  Burkholderia sp. CCGE1003
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bgf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BC1003_1254
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BC1003_1254
   00630 Glyoxylate and dicarboxylate metabolism
    BC1003_1254
Enzymes [BR:bgf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     BC1003_1254
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(1445132..1446727)
Genome map
AA seq 531 aa AA seqDB search
MANSLSSLPQGMEITGEIKPGYEAILTREALELVAALHRTFEPRRQQLLQARAERTKRLD
AGERPDFLAETKSVREGNWTIAPLPQDLQCRRVEITGPVERKMIINALNSGADSYMTDFE
DSNAPSWDNQITGHINLKDAVRRTISLEQNGKRYKLNDKVATLIVRPRGWHLDEKHVKVD
GKRVSGGIFDFALFMMHNAKELVARGSGPYFYLPKMESHLEARLWNDIFVAAQEAVGVPR
GTIRATVLIETILAAFEMDEILYELREHSSGLNAGRWDYIFSAIKKFKSDRDFCLADRSQ
ITMTAPFMRAYALLLLKTCHRRNAPAIGGMSALIPIKNDPVANDKAMAGVRSDKARDAGD
GYDGGWVAHPGLVPIAMEEFVKVLGDKPNQIGKQREDVLVTATDLLDFRPEAPITEAGLR
NNINVGIHYLGSWLAGNGCVPIHNLMEDAATAEISRSQVWQWIRSPKGTLDDGRKVSAEL
VRELAVQELDKVKQTVGGDTKPYERAAQIFEQMSTSEQFTDFLTLPLYEEI
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atggcgaattcgctgtcatcgctgccacagggcatggaaatcaccggcgagatcaagccg
ggctacgaagcgattctcacgcgcgaggcgctcgaactcgtcgctgcgctacatcgcacg
ttcgagccgcgccgtcagcagttgctgcaggcgcgcgccgagcgcacgaaacgtctggac
gcgggtgagcgccccgatttcctcgccgagacgaagagtgtgcgcgaaggtaactggacc
attgcgccactgccgcaagacctgcaatgccgccgcgtggaaatcaccggtccggtcgag
cgcaagatgattatcaacgcgctgaattcgggcgcggattcgtacatgaccgacttcgag
gattcgaatgcgccgagctgggacaaccagatcacgggccatatcaatctgaaggacgcc
gtgcgccgcacgatttcgctcgagcagaacggcaagcgctacaagctgaacgacaaggtc
gccacgctgatcgtgcgcccgcgcggctggcatctcgacgagaaacacgtgaaggtggac
ggcaagcgcgtgtcgggcggcattttcgatttcgcgctcttcatgatgcacaacgcgaag
gaactggtcgcgcgcggctcgggcccgtacttctatcttccgaagatggagagccatctg
gaggcgcgtctgtggaatgacattttcgtcgccgcgcaggaagcggtcggcgtgccgcgc
ggcacgattcgcgcgaccgtgctgatcgaaacgattctcgccgcgttcgaaatggacgag
attctgtacgagctgcgcgagcatagttcggggctcaacgcgggccgctgggactacatc
ttttcagcaatcaagaagttcaagtccgaccgcgacttctgcctcgcggatcgctcgcaa
atcacgatgacggcgcccttcatgcgcgcctatgcgctgttgctgctcaaaacttgccat
cgccgcaacgcaccggccattggcggcatgagcgcgctgattccgatcaagaacgatccg
gtcgcgaacgacaaggcgatggccggcgtgcgctctgacaaggcgcgcgatgccggcgac
ggttacgacggcggctgggtcgcgcacccggggctcgtgccgatcgcaatggaagaattc
gtcaaggtgctcggcgacaagcccaatcagatcggcaagcagcgcgaggacgtgctcgtc
actgcgacggatctgctcgacttccgtccggaggcgccgatcacggaggcaggtctgcgc
aacaacatcaacgtcggcattcactacctgggctcgtggctcgccggcaacggttgcgtg
ccgatccacaatctgatggaagatgccgcgacggccgagatttcgcgctcacaagtctgg
caatggattcgctcgcccaagggcacgctcgacgacggccgcaaggtgagcgccgaactg
gtgcgcgaactcgccgtgcaggagctcgacaaggtcaagcagacggtgggcggcgatacg
aagccctatgagcgcgccgcgcagatcttcgagcagatgtcgacgtcggaacagttcacc
gacttcctgacgctgccgctctacgaagagatctga

DBGET integrated database retrieval system