KEGG   Burkholderia sp. CCGE1003: BC1003_1258Help
Entry
BC1003_1258       CDS       T01314                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
bgf  Burkholderia sp. CCGE1003
Pathway
bgf00630  Glyoxylate and dicarboxylate metabolism
bgf01100  Metabolic pathways
bgf01110  Biosynthesis of secondary metabolites
bgf01120  Microbial metabolism in diverse environments
bgf01200  Carbon metabolism
Module
bgf_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bgf00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BC1003_1258
Enzymes [BR:bgf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     BC1003_1258
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ADN57235
JGI: BC1003_1258
UniProt: E1T4S9
Position
1:complement(1449966..1451273)
Genome map
AA seq 435 aa AA seqDB search
MTTREEQARQLQQQWETDPRWKGVKRTYTAEDVIRLRGSVQVEHTLAKRGAEKLWHSVNT
EPFVNSLGALTGNQAMQQVKAGLKAIYLSGWQVAGDANVAGEMYPDQSLYPANSVPLVVK
RINNTLTRADQIQWSEGKNPGDEGYIDYFAPIVADAEAGFGGVLNAFELMKAMIEAGAAG
VHFEDQLASVKKCGHMGGKVLVPTRENIAKLTAARLAADVSGVPTVLLARTDAEAADLIT
SDVDENDKPFMTGERTVEGFYRTKPGLEQAISRGLAYAPYADMIWCETGKPDLEFAKKFA
DAIHKEYPDQLLSYNCSPSFNWKKNLDDATIAKFQRELGAMGYKFQFITLAGFHALNYSM
FNLAHGYARNQMTAFVEMQQAEFAAAEKGFTAVKHQREVGTGYFDAVTQTVEREASTTAL
HGSTEDEQFFDKKVA
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgcgcgaagaacaggcccgccaacttcaacagcaatgggaaaccgatccgcgc
tggaaaggcgtgaagcgcacctacaccgccgaagacgtgatccgtctgcgcggctccgtg
caggtcgagcacacgctcgccaaacgcggcgccgaaaagctctggcatagcgtgaatacg
gagccgttcgtcaactcgctcggcgcgctgaccggcaatcaggcgatgcaacaggtcaag
gccggcctgaaagcgatctacctgtcaggctggcaggtcgcgggcgatgcgaacgtggcc
ggcgaaatgtaccccgaccagtcgctctacccggcgaactccgtgccgctcgtcgtcaag
cgcatcaacaacacgctcacccgggccgaccagattcagtggtccgaaggcaagaatccc
ggcgacgaaggctacatcgactatttcgcgccgatcgtcgccgacgcggaagccggtttt
ggcggcgtgctgaacgcgttcgagctgatgaaggccatgatcgaagccggcgccgctggc
gtgcacttcgaggatcagctcgcctcggtgaagaaatgcggccacatgggcggcaaggtg
ctcgtgccgacgcgtgaaaacatcgccaagctcaccgccgcgcgtctggctgccgacgtc
tcgggcgtgccgaccgtgctgctcgcccgcaccgatgccgaagccgccgatctgatcacc
tcggacgtggacgaaaacgacaagccgttcatgaccggcgagcgcaccgtcgaaggtttc
taccgcacgaagccgggtctcgagcaggcgatttcgcgcggcctcgcctacgcgccgtac
gccgacatgatctggtgcgagacgggcaagccggacctcgagttcgcgaagaaattcgcc
gacgcgatccacaaggagtacccggatcagttgctgtcctacaactgctcgccgtcgttc
aactggaagaagaatctggacgacgcgaccatcgccaagttccagcgcgaactgggcgcg
atgggctacaagttccagttcatcacgctggccggcttccatgcgctgaactactcgatg
ttcaacctcgcgcacggctacgcccgcaaccagatgactgcgttcgtcgagatgcagcag
gccgaattcgcggcagcggaaaagggctttaccgcggtcaagcatcagcgcgaagtgggc
accggctatttcgacgcggtcacgcagacggtggagcgcgaagcgtcgactaccgcgctg
catggctcgaccgaagacgaacagttcttcgacaagaaggttgcgtga

DBGET integrated database retrieval system