KEGG   Burkholderia sp. CCGE1003: BC1003_1272Help
Entry
BC1003_1272       CDS       T01314                                 

Definition
(GenBank) Peroxiredoxin
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
bgf  Burkholderia sp. CCGE1003
Pathway
bgf00480  Glutathione metabolism
bgf00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:bgf00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    BC1003_1272
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BC1003_1272
Enzymes [BR:bgf01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     BC1003_1272
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: ADN57249
JGI: BC1003_1272
UniProt: E1T4U3
Position
1:1466613..1467092
Genome map
AA seq 159 aa AA seqDB search
MTSIYSFSARTLGGDEVSLAQYEGKVLLIVNTASECGFTPQYAGLQKLYDTYAARGLTVL
GFPCNQFGKQEPGDAAQIGSFCEKNYGVTFPMFDKVDVNGANAHPLFRYLTGEAPGLLGL
EAIKWNFTKFLIGRDGNVVKRYAPLTKPEAITEDIEKLL
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgacatcgatttattctttttcggcccgcacgctaggcggcgacgaagtgagtctcgcg
cagtacgaaggcaaggtgctgctgatcgtcaacacggcgagcgaatgcgggttcacgccg
caatacgcaggcttgcagaagctctacgacacctatgcggcgcgcgggctcacggtgctc
ggctttccatgcaatcagttcggcaagcaggaaccgggcgacgcggcgcagatcggcagc
ttctgcgagaaaaattacggcgtgacctttccgatgttcgacaaggtcgacgtgaacggt
gcgaacgcgcatccgctgttccgctatctgacgggcgaggcgccgggtctgctcggcctc
gaagcgatcaagtggaatttcacgaagttcctgatcggccgcgacggcaatgtggtcaag
cgctatgcgccgctcaccaagcccgaggcgattaccgaggacatcgaaaagctgttgtga

DBGET integrated database retrieval system