KEGG   Burkholderia sp. CCGE1003: BC1003_1541Help
Entry
BC1003_1541       CDS       T01314                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
bgf  Burkholderia sp. CCGE1003
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bgf00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BC1003_1541
DNA repair and recombination proteins [BR:bgf03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      BC1003_1541
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1765763..1766359
Genome map
AA seq 198 aa AA seqDB search
MKQPSALSALVEALRALPGVGPKSAQRMAYHLMQHDRDGAEKLGRALLFATEHLQHCEKC
NTFTEAQVCEVCLDPERDPTLLCVVETPADQIMLEQTMTYRGLYFVLMGRLSPLDGIGPK
EIHFDRLVKRASDGVVKEVVLATNFTNEGEATAHYLGQTLKARGLTVTRLARGVPVGGEL
EYVDAGTIARAMLDRRSM
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaccttccgccttgtcggcgctcgtcgaagcgctgcgcgcgctgcccggagtc
gggccgaagtccgcgcaacgcatggcgtatcacctgatgcagcacgaccgtgacggcgcc
gaaaagctcggccgcgcgttgctgttcgcgaccgagcatctgcagcactgcgagaagtgc
aataccttcaccgaagcgcaggtctgcgaggtgtgcctcgaccccgagcgcgatccgacg
ctgctatgcgtcgtcgaaacgcctgccgaccagatcatgctcgagcagaccatgacctat
cgcggtctgtatttcgtgctgatgggacggctcagtccactcgacggcatcggtcccaaa
gagatacatttcgaccggctggtgaagcgcgcgtcggacggcgtcgtgaaggaagtcgtg
ctggccaccaacttcaccaacgaaggcgaagccaccgcgcattacctcgggcaaacgctc
aaggcgcgcggtctgaccgtcacgcgcctcgcccgcggcgtgccggtgggcggcgaactc
gaatacgtcgacgcgggcaccatagcccgcgcgatgctcgaccgccgctcgatgtag

  All links  
No link information was found.   
DBGET integrated database retrieval system