KEGG   Burkholderia sp. CCGE1003: BC1003_1688Help
Entry
BC1003_1688       CDS       T01314                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bgf  Burkholderia sp. CCGE1003
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bgf00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BC1003_1688
   00052 Galactose metabolism
    BC1003_1688
   00500 Starch and sucrose metabolism
    BC1003_1688
   00520 Amino sugar and nucleotide sugar metabolism
    BC1003_1688
Enzymes [BR:bgf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BC1003_1688
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1941569..1942495
Genome map
AA seq 308 aa AA seqDB search
MLKVTKAVFPVAGLGTRFLPATKASPKEMLPIVDKPLIQYAVEEAVAAGITEMIFVTGRS
KRAIEDHFDKSYEIEAELEARNKQKLLDLVRSIKPANVDCFYVRQAEALGLGHAVLCAEK
LVGQSPFAVILADDLLHSSKPVMSQLVDTFNHYHSSVIGVETIAREDSRSYGVVDGREWE
DNVIKLSGIVEKPAPDKAPSNLGVVGRYVLMPTIFKHIRALKPGAGGELQLTDAVQSLLT
EEQVLAYRYFGTRFDCGSKLGYLKATVEFALRHPEVKDEFEAYLQAYMQANGQANAQDLP
AQYTAEAA
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaagtcaccaaagccgtgtttcccgtagcgggcctcgggacacgtttcctgccg
gctaccaaggcaagtccgaaagaaatgctgcctatcgtcgacaagccgctgatccagtac
gctgtcgaagaagcagttgctgccggcatcaccgagatgatcttcgtgacgggtcgcagc
aagcgcgctatcgaagatcacttcgacaaatcgtatgaaatcgaggccgagctcgaggcg
cgcaacaagcagaagctgctcgacctcgtgcgcagcatcaagccggccaacgtcgactgc
ttctatgttcgccaggccgaagcattgggtctcggtcatgcggtgctatgcgccgaaaag
ctggtcggtcaaagcccgttcgcggtgattcttgcagacgacctgctgcacagctcgaag
ccggtcatgagccagctcgtggatacgttcaatcactaccatagctcggtgatcggcgtt
gaaaccattgcgcgcgaagacagccgctcatatggtgtggtggacggccgcgagtgggaa
gacaacgtcatcaagctctcgggcattgtcgagaaaccggcgccggacaaggcaccgtcg
aacctcggcgtggttgggcgctatgtgctcatgccgaccatctttaagcacattcgcgcg
ctcaagcccggtgccggcggcgaattgcaattgacggacgcggttcagtcgctgctcacc
gaagaacaggtgcttgcgtatcgctacttcggcacgcgcttcgattgcggcagcaagctc
ggctatctgaaggcgacggtggagttcgcgttgcgccatcccgaggtgaaggacgagttc
gaagcgtatctgcaggcttatatgcaggcaaacgggcaggcaaacgcgcaggacctgccg
gcacagtacaccgctgaagcggcttga

DBGET integrated database retrieval system