KEGG   Burkholderia sp. CCGE1003: BC1003_1988Help
Entry
BC1003_1988       CDS       T01314                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bgf  Burkholderia sp. CCGE1003
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bgf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BC1003_1988
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BC1003_1988
  Amino acid metabolism
   00310 Lysine degradation
    BC1003_1988
Enzymes [BR:bgf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BC1003_1988
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2294142..2295425)
Genome map
AA seq 427 aa AA seqDB search
MAIVEVKVPQLSESVSEATMLQWKKKPGEAVAQDEILIEIETDKVVLEVPAPAAGVLAQV
IANDGDTVTADQVIAKIDTEGTAGAAAVEAEVKPAPVAAPAPAPAAAPAAQAASATGANT
AASPAAGKLMAEKGLAAGDVAGTGRDGRITKGDVLSAGAPAAKTAAPAPAAAPRAAKPAL
PDVKAPASAEQWLKDRPEQRVPMSRLRARIAERLLESQQTNAILTTFNEVNMAPVMDLRN
KYKDKFEKEHGVKLGFMSFFVKAAVHALKKFPLVNASIDGNDIVYHGYFDIGIAVGSPRG
LVVPILRNADQLSLAEIEKKIAEFGQKAKDGKLSIEEMTGGTFSISNGGVFGSMLSTPII
NPPQSAILGVHATKERAVVENGQIVIRPMNYLALSYDHRIIDGREAVLSLVAMKDALEDP
ARLLLDL
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggctattgttgaagtcaaggttccccagctgtccgagtcggtctcggaagccacgatg
ctgcagtggaagaagaagcccggcgaggctgttgctcaagacgaaattctcatcgaaatc
gagaccgacaaggtcgtgctcgaagtgccggcacccgcagccggcgtgctcgcgcaagtc
atcgcgaacgacggcgacacggtcaccgctgaccaggtcatcgccaagatcgacacggaa
ggcaccgcaggcgccgctgctgtcgaagccgaagtgaagcccgcgcccgtggccgctccg
gctccggcgccggctgctgcaccggccgcgcaagctgcatccgcaacgggtgcgaacacc
gctgcttcgccggccgccggcaagctgatggcagaaaagggcttggccgctggcgacgtc
gccggcacgggccgcgacggccgcatcaccaagggcgacgtgctgagcgccggcgcgcct
gccgcaaagaccgctgcgcccgcaccggccgctgcaccgagggccgccaagcctgcgctg
ccggacgtgaaggcgccggcctcggccgagcaatggctgaaggaccgcccggaacaacgc
gtgccgatgtcgcgtctgcgcgcgcgtatcgccgagcgtctgctcgagtcgcagcaaacc
aacgccatcctgaccacgttcaacgaagtcaacatggcgccggtcatggatctgcgcaac
aagtacaaggacaagttcgaaaaggaacatggcgtgaagctcggcttcatgtcgttcttc
gtgaaggcggctgtgcacgcgctgaagaagttcccgctggtgaacgcgtcgatcgacggt
aacgacatcgtctatcacggctacttcgacatcggtatcgctgtcggttcgccgcgcggc
ctggtggtgccgatcctgcgcaatgcggatcagctgagcctcgccgaaatcgagaagaag
attgccgagttcggtcagaaggcgaaggacggcaagctgtccatcgaagaaatgacgggt
ggtacgttctcgatctcgaacggcggcgtattcggctcgatgctgtcgacgccgatcatc
aacccgccgcagtccgcgattctcggcgtgcacgcaacgaaggaacgcgctgtcgtcgaa
aacggccagatcgtgatccgtccgatgaactatctggcgctctcgtatgaccaccggatc
atcgacggtcgcgaagccgtgctgtcgctcgtcgcgatgaaggacgcgctggaagatccg
gcgcgcctgctgctcgacctgtaa

DBGET integrated database retrieval system