KEGG   Burkholderia sp. CCGE1003: BC1003_2097Help
Entry
BC1003_2097       CDS       T01314                                 

Definition
alpha/beta hydrolase fold protein
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bgf  Burkholderia sp. CCGE1003
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bgf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BC1003_2097
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BC1003_2097
   00020 Citrate cycle (TCA cycle)
    BC1003_2097
   00620 Pyruvate metabolism
    BC1003_2097
Enzymes [BR:bgf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BC1003_2097
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2430997..2432106)
Genome map
AA seq 369 aa AA seqDB search
MAAITPIVMPKWGLEMREGTVQDWLVREGERIEVGTALLDVDTDKISNSVEAPDAGLLRR
IVAQSGETLPVKALLGVLAEMDVSDAEIDAYIAAFEVPAIDGDDEDAGPAFDYVEVNGIR
VRYARRGPESGTPVLFIHGFGGDLNNWLFNLDAVAEAHPVIALDLPAHGLSQVRLAGTTL
QELAAFVGRFLEAIDVPSAHLVGHSMGGGVAAQLAVDAPGKVRSLALIGSAGFGDEVNAE
YTDGFVRAQSRRELKPVAELLFNDTALVSRQLLDDLLKYKRLDGVGEALGALGTQLFGGG
RQREQPGRALSRFDGPVLVVWGREDRIIPSAHAAAAPAGAVVEVLEGAGHMPQMEKANEV
NALLRRHLG
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggccgcaattaccccgatcgtcatgcccaagtgggggctggagatgcgcgaaggcacg
gtgcaggactggctggttcgggaaggcgagcgcatcgaagtaggaacggcgctgctcgac
gtggacaccgacaagatttccaactcggtggaagcccccgatgcgggactgctgcgccgc
atcgttgcgcagagcggcgagacgctgcccgtcaaggcgttgctcggcgtgctggcggag
atggacgtaagcgatgccgagatcgatgcatacatcgccgctttcgaggtgcccgccatc
gacggcgacgacgaggacgccggcccggcgttcgactacgtcgaggtaaatggcatccgt
gtgcgctatgcgagacgtgggccggagtcgggcacgccggtgctcttcatccacggcttc
ggcggcgatctgaacaactggcttttcaacctcgatgcagtggctgaggcgcatccggtg
atcgcactcgatctgcctgcacacggcctgtcccaggtgcggctcgcgggcacgacgctg
caggaactggccgccttcgtcggccgcttcctggaggcgatcgatgtgccgtcggcccat
ctggtcggccactcgatgggcggcggcgtggccgcgcaactggcggtggatgcgccgggc
aaggtccgttcgctggcgctgatcggcagcgccggcttcggagacgaagtcaacgccgaa
tacaccgacggcttcgtgcgcgcgcagtcgcgccgcgaactgaagcccgtggccgaactg
ctgttcaacgacacggcgctcgtgagccgacagctgctggacgatctgctcaagtacaag
cggctcgacggtgtcggtgaagcgctcggcgcgctcggcacccagctattcggcggcggc
aggcaacgcgagcagcccggccgggcgctcagccgcttcgacgggccggtgctggtggtt
tggggccgcgaggatcgcatcattcccagcgcccatgcggccgccgcgcctgccggcgcg
gtagtggaagtgctcgaaggtgctggccacatgccgcagatggaaaaggccaacgaggtg
aacgcgctgctgcgccggcacctgggctag

DBGET integrated database retrieval system