KEGG   Burkholderia sp. CCGE1003: BC1003_2116Help
Entry
BC1003_2116       CDS       T01314                                 

Definition
response regulator receiver modulated CheB methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
bgf  Burkholderia sp. CCGE1003
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:bgf02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:bgf02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2450538..2451623)
Genome map
AA seq 361 aa AA seqDB search
MARIRVLIVDDSAVVRQVVSGMLTEAGIEVMDAVADPIAAMSRLVHGWPDVILLDVEMPR
MDGITFLKKIMAERPTPVVICSTLTEKGARTTIDAMAAGAVSVVAKPRLGLKQFLLESAE
ELTTTIRAATRVNATRLARRHPVAAPVPKHTADAVLPPGVPGTSGALSQMTERIVAIGTS
TGGTQALEVVLTALPRVSPGIVVVQHMPEKFTAAFAERLNRLCEIEVKEAQSNDRVTQGR
ALIAPGGKHLAVRRSGAQHVVDVIDGPLVNRHRPSVDVLFRSVARSAGRNALGIIMTGMG
DDGAAGLAEMHAAGARTVAQDEESCVVFGMPREAIKRGGVDKVVPLSAISKEIALVQAQR
S
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggctcgaatccgtgtattgatcgtagacgactccgctgtcgtcaggcaggtggtgtcc
ggcatgctcacggaggctggtatcgaagtgatggatgcggtcgcagaccccatcgccgcg
atgagccgtctcgtgcacggctggcccgacgtgatcctgcttgacgtcgagatgccgcgt
atggacggcattacgtttctcaagaaaatcatggcggagcggcccacgcccgtcgtgatc
tgctccacgctcaccgagaaaggcgcccgcacgaccatcgacgcgatggcggcaggcgct
gtgtcagttgtcgccaagcctcggctcggtctcaagcagtttctgctggagagcgccgaa
gaactgaccacgacgattcgcgctgcaacgcgcgtgaatgccacgcggctagcgcgcaga
catccggtagccgctcctgtgcccaaacataccgcggatgcggtgttgccgccgggcgtg
cccggcacatcgggcgcactctcgcaaatgaccgagcgcattgtggcgatcggcacgtcg
acgggcggcacgcaagcgctcgaagtcgtattgacggcgctaccgcgtgtttcacctggc
atcgtcgtcgtgcagcacatgcccgaaaagtttacggcggcgtttgccgagcggctcaat
cgcctttgcgaaatcgaggtcaaggaagctcagtccaacgatcgggtaacgcagggccgt
gcgctgatcgcgccaggcggcaagcacctggctgtgcgtcgcagcggcgcgcaacatgtc
gtcgacgtcatcgacggaccgctcgtcaatcgccatcgtccctcggtcgacgtgctgttt
cgctcggtggcccgcagcgcgggccgcaacgcgctgggcatcatcatgaccggcatgggc
gacgacggcgcggccgggctcgccgaaatgcatgccgccggtgcgcgtacagtcgcgcag
gacgaggagagctgcgtcgtattcggcatgccgcgggaagcgatcaaacgcggcggcgtc
gacaaggtggtgccgctttccgcgatcagcaaggagatcgcgctggttcaggcgcaacgc
agctga

DBGET integrated database retrieval system