KEGG   Burkholderia sp. CCGE1003: BC1003_2132Help
Entry
BC1003_2132       CDS       T01314                                 

Definition
alcohol dehydrogenase zinc-binding domain-containing protein
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
bgf  Burkholderia sp. CCGE1003
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bgf00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BC1003_2132
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BC1003_2132
  Lipid metabolism
   00071 Fatty acid degradation
    BC1003_2132
  Amino acid metabolism
   00350 Tyrosine metabolism
    BC1003_2132
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BC1003_2132
   00626 Naphthalene degradation
    BC1003_2132
Enzymes [BR:bgf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BC1003_2132
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2468618..2469697
Genome map
AA seq 359 aa AA seqDB search
MKAAILKTLGEPLAIEDIPDPSLGTGEVIVDIAAAPVLSYAQEVFSGERRYPIELPIVPG
CGAIGRVRAFGPDATHLKTGDWVFCDPTVRSRDDALTPDITLQGWSARGDGGLRLARHFH
HGPFAAQMRVPTENAIRIGDISPADASKWCALNTMLVPYGGLLASNLQAGETLLVSGATG
NFGSACVAVALAMGVRCVVAPGRNERVLADLRRRFGERIRTVKLTGNEDDDRERMRAAAG
APIDCVMDLLPPSATTRTVRAAVMAVRPYGRIVLMGGVGMLGGDGLDLPYPWIMRNDITV
RGKWMYPPQAVTLMTGLIRGGLLDLALFDVTSFKLDDVNEAIGHAAANGGPFRMTVVHP
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcgattttgaagacacttggcgagccgcttgcgattgaagacataccagat
ccttcgctgggcaccggcgaagtgatcgtcgacatcgctgccgcgccagtgctgtcgtat
gcacaagaagtgttcagcggcgagcgccgctacccgatcgaattgccaatcgtgcccggc
tgcggggcaatcggtcgcgtgcgtgcgtttggcccggacgccacacatctgaagacaggc
gactgggttttctgcgatccgaccgttcgttcacgcgacgacgcgctcacgcccgacatt
acattgcagggctggagtgcacgcggcgacggcggcctgcggctcgcgcgccatttccac
cacggcccattcgcagcacaaatgcgcgtgcccaccgaaaacgccattcgcatcggtgac
atcagtcccgcagacgcctcgaaatggtgcgcgctcaacacaatgctggttccgtacggc
gggctgcttgcgtcgaatctgcaggctggcgagacattgcttgtgagcggcgcaaccggc
aacttcggcagcgcgtgcgtagccgtcgccctcgcaatgggtgtgcgctgcgtggtcgcg
ccaggccgcaacgaacgcgtgctcgcggatctgcgaaggcgcttcggcgaacgcatccgt
acagtgaagttaactggcaacgaggacgacgatcgggaacggatgcgtgcggctgccgga
gcccccatcgactgcgtaatggatctgctgccgccatccgcgaccacgaggacggtgcgc
gcggcagtgatggccgtgcggccctatggacgcattgtgttaatgggcggtgtcggtatg
ctcggcggcgacggtctcgatctgccctatccgtggatcatgcgcaacgacatcaccgtg
cggggcaaatggatgtatccgccgcaagcggttacgcttatgaccggcctgatccgtggc
ggtctgctcgacctcgctcttttcgacgtgacgtccttcaaactggacgacgtgaacgaa
gccatcggtcatgctgcggcaaatggcggcccgttcaggatgacggtcgtccatccataa

DBGET integrated database retrieval system