KEGG   Burkholderia sp. CCGE1003: BC1003_2250Help
Entry
BC1003_2250       CDS       T01314                                 

Definition
acetate/CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bgf  Burkholderia sp. CCGE1003
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bgf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BC1003_2250
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BC1003_2250
   00620 Pyruvate metabolism
    BC1003_2250
   00640 Propanoate metabolism
    BC1003_2250
  Energy metabolism
   00680 Methane metabolism
    BC1003_2250
Enzymes [BR:bgf01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BC1003_2250
Lipid biosynthesis proteins [BR:bgf01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BC1003_2250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2659902..2661884)
Genome map
AA seq 660 aa AA seqDB search
MSAIESVLQERRVFPPSAEAAAGATISGMDAYHALTAEAERDYEGFWGRLARETLSWNKP
FTKVLDESNAPFYTWFEDGQLNASYNSIDRHVEAGNGERVAIIFEADDGTVTHVTYQDLL
QRVSRFANALKKRGVKKGDRVVIYMPMSIEGIVAMQACARIGATHSVVFGGFSSKSLNER
LVDVGAVALVTSDEQMRGGKALPLKNIADEALAMGGCEAVKSVIVFRRTGGKIAWNEGRD
LWMHELAQAESDQCAPEWVGAEHPLFILYTSGSTGKPKGVQHSTGGYLLWAAQTMKWTFD
WKPSDVFWCTADIGWITGHSYITYGPLTLGGTQVVFEGVPTYPNAGRFWDMIAKHKVSLF
YTAPTAIRSLIKASEADPKVHPKSYDLSTLRIIGTVGEPINPEAWVWYHENVGGGRCPIV
DTWWQTETGGHMITPLPGATPLVPGSCTLPLPGIMAAVVDETGQDVPNGQGGILVVKRPW
PSMLRNVWGDPDRYKKSYFPEELGGKLYLAGDGAVRDKETGYFTIMGRIDDVLNVSGHRL
GTMEIESALVSNPIVAEAAVVGRPDATTGEAVCAFVVLKRARPQGDEAVKLANELRNWVG
KEIGPIAKPKDIRFGENLPKTRSGKIMRRLLRSLAKGEAITQDVSTLENPAILDQLGESL
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcgattgaatcggttcttcaggaacgccgtgtttttccgccctccgctgaagca
gcggcaggcgccacgatctccggcatggatgcttaccatgcgctgaccgccgaggcggaa
cgcgactacgagggcttctgggggcgtcttgcgcgcgagacgctgagctggaacaagccc
ttcacgaaggtgctcgacgaatcgaacgcaccgttctacacgtggttcgaagacggccag
ttgaacgcgtcgtacaacagcatcgaccgtcacgtggaagcgggcaacggcgagcgcgtg
gcgatcattttcgaagccgacgacggcaccgtcactcacgtcacctatcaggatctgctg
caacgcgtgtcgcgctttgcgaacgcgttgaaaaagcgtggcgtgaagaagggcgaccgc
gtggtcatctatatgccgatgtcgattgaaggcatcgtcgcgatgcaggcctgcgcgcgt
atcggcgcgacgcactcggtggtgttcggcggcttctcgtcgaagtcgctcaacgagcgt
ctcgtcgacgtcggcgcggtcgcgctcgtgacctccgacgaacagatgcgcggcggcaag
gcattgccgctgaagaacatcgccgacgaagcgctcgccatgggcggctgcgaggccgtg
aagagcgtgattgtgttcaggcgcaccggcggcaagatcgcctggaacgaaggccgcgac
ctgtggatgcacgagcttgcgcaagccgagtccgatcaatgcgcgcccgaatgggtcggc
gcggagcatccgcttttcatcctctacacgtccgggtccacgggcaagcccaaaggcgtg
cagcacagcaccggcggttatctgctgtgggccgcgcaaaccatgaagtggaccttcgac
tggaagccctccgacgtgttctggtgtaccgcggacatcggctggattaccggtcacagc
tacatcacgtatggcccgctcacgctcggcggcacgcaggtcgtgttcgaaggcgtgccg
acatatccgaatgccggccgcttctgggacatgatcgcgaagcacaaggtgtcgcttttc
tataccgcgccgaccgccatccgctcgctcatcaaggcgtccgaggcggacccgaaagtg
catccgaagagttatgacctgtccacgctgcgcatcatcggcacggtcggcgagccgatc
aaccctgaagcgtgggtgtggtatcacgagaacgtcggcggcggccgttgcccgattgtc
gatacgtggtggcaaaccgagaccggcggccacatgatcacgccgctgccgggcgcgacc
ccgctcgtgccgggttcgtgcacgctgcctttgccgggcatcatggctgcggtcgtcgac
gaaaccggtcaggacgtgccgaacgggcagggcggcattctcgtcgttaagcggccgtgg
ccctccatgctgcgcaacgtgtggggcgatccggaccgctacaagaagagctatttcccc
gaggagctgggcggcaaactgtatctcgccggcgacggcgccgtgcgcgacaaggagact
ggctacttcacgatcatgggtcgtatcgacgacgtgctgaacgtgtccggccatcgtctc
ggcacaatggaaatcgagtcggcgctggtgtcgaatccgatcgtcgccgaagccgccgta
gtggggcgcccggatgctacgaccggcgaagcggtgtgcgcgttcgtcgtgttgaagcgc
gcgcgtccacaaggcgacgaagcggtgaaactcgcgaacgaactgcgcaactgggtgggc
aaggaaatcggtccgatcgccaagccgaaggacatccgcttcggtgaaaacctgccgaag
acgcgttcgggcaagatcatgcgccgtctgttgcgctcgctggcgaagggcgaggcgatc
acgcaggacgtctccacgctcgaaaacccggcgattctggatcagctcggcgagtcgctg
taa

DBGET integrated database retrieval system