KEGG   Burkholderia sp. CCGE1003: BC1003_2250Help
Entry
BC1003_2250       CDS       T01314                                 

Definition
(GenBank) acetate/CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bgf  Burkholderia sp. CCGE1003
Pathway
bgf00010  Glycolysis / Gluconeogenesis
bgf00620  Pyruvate metabolism
bgf00640  Propanoate metabolism
bgf00680  Methane metabolism
bgf01100  Metabolic pathways
bgf01110  Biosynthesis of secondary metabolites
bgf01120  Microbial metabolism in diverse environments
bgf01130  Biosynthesis of antibiotics
bgf01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bgf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BC1003_2250
   00620 Pyruvate metabolism
    BC1003_2250
   00640 Propanoate metabolism
    BC1003_2250
  Energy metabolism
   00680 Methane metabolism
    BC1003_2250
Enzymes [BR:bgf01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BC1003_2250
Lipid biosynthesis proteins [BR:bgf01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BC1003_2250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N DUF1967
Motif
Other DBs
NCBI-ProteinID: ADN58203
JGI: BC1003_2250
UniProt: E1TCY8
Position
1:complement(2659902..2661884)
Genome map
AA seq 660 aa AA seqDB search
MSAIESVLQERRVFPPSAEAAAGATISGMDAYHALTAEAERDYEGFWGRLARETLSWNKP
FTKVLDESNAPFYTWFEDGQLNASYNSIDRHVEAGNGERVAIIFEADDGTVTHVTYQDLL
QRVSRFANALKKRGVKKGDRVVIYMPMSIEGIVAMQACARIGATHSVVFGGFSSKSLNER
LVDVGAVALVTSDEQMRGGKALPLKNIADEALAMGGCEAVKSVIVFRRTGGKIAWNEGRD
LWMHELAQAESDQCAPEWVGAEHPLFILYTSGSTGKPKGVQHSTGGYLLWAAQTMKWTFD
WKPSDVFWCTADIGWITGHSYITYGPLTLGGTQVVFEGVPTYPNAGRFWDMIAKHKVSLF
YTAPTAIRSLIKASEADPKVHPKSYDLSTLRIIGTVGEPINPEAWVWYHENVGGGRCPIV
DTWWQTETGGHMITPLPGATPLVPGSCTLPLPGIMAAVVDETGQDVPNGQGGILVVKRPW
PSMLRNVWGDPDRYKKSYFPEELGGKLYLAGDGAVRDKETGYFTIMGRIDDVLNVSGHRL
GTMEIESALVSNPIVAEAAVVGRPDATTGEAVCAFVVLKRARPQGDEAVKLANELRNWVG
KEIGPIAKPKDIRFGENLPKTRSGKIMRRLLRSLAKGEAITQDVSTLENPAILDQLGESL
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcgattgaatcggttcttcaggaacgccgtgtttttccgccctccgctgaagca
gcggcaggcgccacgatctccggcatggatgcttaccatgcgctgaccgccgaggcggaa
cgcgactacgagggcttctgggggcgtcttgcgcgcgagacgctgagctggaacaagccc
ttcacgaaggtgctcgacgaatcgaacgcaccgttctacacgtggttcgaagacggccag
ttgaacgcgtcgtacaacagcatcgaccgtcacgtggaagcgggcaacggcgagcgcgtg
gcgatcattttcgaagccgacgacggcaccgtcactcacgtcacctatcaggatctgctg
caacgcgtgtcgcgctttgcgaacgcgttgaaaaagcgtggcgtgaagaagggcgaccgc
gtggtcatctatatgccgatgtcgattgaaggcatcgtcgcgatgcaggcctgcgcgcgt
atcggcgcgacgcactcggtggtgttcggcggcttctcgtcgaagtcgctcaacgagcgt
ctcgtcgacgtcggcgcggtcgcgctcgtgacctccgacgaacagatgcgcggcggcaag
gcattgccgctgaagaacatcgccgacgaagcgctcgccatgggcggctgcgaggccgtg
aagagcgtgattgtgttcaggcgcaccggcggcaagatcgcctggaacgaaggccgcgac
ctgtggatgcacgagcttgcgcaagccgagtccgatcaatgcgcgcccgaatgggtcggc
gcggagcatccgcttttcatcctctacacgtccgggtccacgggcaagcccaaaggcgtg
cagcacagcaccggcggttatctgctgtgggccgcgcaaaccatgaagtggaccttcgac
tggaagccctccgacgtgttctggtgtaccgcggacatcggctggattaccggtcacagc
tacatcacgtatggcccgctcacgctcggcggcacgcaggtcgtgttcgaaggcgtgccg
acatatccgaatgccggccgcttctgggacatgatcgcgaagcacaaggtgtcgcttttc
tataccgcgccgaccgccatccgctcgctcatcaaggcgtccgaggcggacccgaaagtg
catccgaagagttatgacctgtccacgctgcgcatcatcggcacggtcggcgagccgatc
aaccctgaagcgtgggtgtggtatcacgagaacgtcggcggcggccgttgcccgattgtc
gatacgtggtggcaaaccgagaccggcggccacatgatcacgccgctgccgggcgcgacc
ccgctcgtgccgggttcgtgcacgctgcctttgccgggcatcatggctgcggtcgtcgac
gaaaccggtcaggacgtgccgaacgggcagggcggcattctcgtcgttaagcggccgtgg
ccctccatgctgcgcaacgtgtggggcgatccggaccgctacaagaagagctatttcccc
gaggagctgggcggcaaactgtatctcgccggcgacggcgccgtgcgcgacaaggagact
ggctacttcacgatcatgggtcgtatcgacgacgtgctgaacgtgtccggccatcgtctc
ggcacaatggaaatcgagtcggcgctggtgtcgaatccgatcgtcgccgaagccgccgta
gtggggcgcccggatgctacgaccggcgaagcggtgtgcgcgttcgtcgtgttgaagcgc
gcgcgtccacaaggcgacgaagcggtgaaactcgcgaacgaactgcgcaactgggtgggc
aaggaaatcggtccgatcgccaagccgaaggacatccgcttcggtgaaaacctgccgaag
acgcgttcgggcaagatcatgcgccgtctgttgcgctcgctggcgaagggcgaggcgatc
acgcaggacgtctccacgctcgaaaacccggcgattctggatcagctcggcgagtcgctg
taa

DBGET integrated database retrieval system