KEGG   Burkholderia sp. CCGE1003: BC1003_2322Help
Entry
BC1003_2322       CDS       T01314                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bgf  Burkholderia sp. CCGE1003
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bgf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BC1003_2322
   01230 Biosynthesis of amino acids
    BC1003_2322
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BC1003_2322
   00051 Fructose and mannose metabolism
    BC1003_2322
   00562 Inositol phosphate metabolism
    BC1003_2322
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BC1003_2322
Enzymes [BR:bgf01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BC1003_2322
Exosome [BR:bgf04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BC1003_2322
  Exosomal proteins of bladder cancer cells
   BC1003_2322
  Exosomal proteins of melanoma cells
   BC1003_2322
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2735893..2736672)
Genome map
AA seq 259 aa AA seqDB search
MSTQRAKLVVGNWKMHGRLADNAGLLQAVAKGAGELPATVRVGVCVPSPYLAQANSLLDG
TRVAWGVQDVSAFTHGAYTGEVAAQMVTDFGATFAIVGHSERRAYHRESAELVAIKTQRA
LEAGLTPIVCVGETLEEREAGATEQVVGAQLDEVLARLSVQEAARIVVAYEPVWAIGTGK
SASSQQAQAVHAFLRARLAAKGAQVAGVPLLYGGSVKPDNAKELFCQQDIDGGLIGGASL
KDQDFLAICKAAAEATAAG
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacacaacgagccaaactggtagtgggtaactggaagatgcacgggcgccttgcc
gataacgcggggctcttgcaggccgtggcgaaaggcgcgggcgaactgccggcgacggtg
cgcgtgggtgtgtgcgtgccgagcccgtatctcgcccaggcaaattcgctgctcgacggc
actcgcgtggcgtggggcgtgcaggacgtttcggcgttcacgcacggcgcgtataccggc
gaagtcgccgcgcaaatggtgacggatttcggcgccacgtttgccattgtcgggcattcg
gagcgccgcgcgtatcaccgcgagagcgccgaactcgtcgcgatcaagacgcagcgtgcg
ctggaggcgggtttgacgccgatcgtgtgcgtcggcgaaacgctcgaagagcgggaagcg
ggcgcgaccgaacaggtggttggcgcgcagctggacgaagtgctggccaggttgtcggtg
caggaagccgcgcgtatcgtggtcgcctacgagcccgtctgggcaatcggcacgggcaag
agcgcaagctcgcagcaggcgcaggcggtgcacgcattcctgcgcgcgcgtctcgcggca
aaaggcgctcaagttgcaggcgtgccgctgctgtacggcggcagtgtgaagcccgacaac
gcgaaagagttgttctgtcagcaggatatcgacggcggcctgattggcggtgcgtcgctg
aaggaccaagattttctggcgatctgcaaggcggcggccgaagcgacggccgcaggttga

DBGET integrated database retrieval system