KEGG   Burkholderia sp. CCGE1003: BC1003_2878Help
Entry
BC1003_2878       CDS       T01314                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bgf  Burkholderia sp. CCGE1003
Pathway
bgf00020  Citrate cycle (TCA cycle)
bgf00640  Propanoate metabolism
bgf00660  C5-Branched dibasic acid metabolism
bgf01100  Metabolic pathways
bgf01110  Biosynthesis of secondary metabolites
bgf01120  Microbial metabolism in diverse environments
bgf01130  Biosynthesis of antibiotics
bgf01200  Carbon metabolism
Module
bgf_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bgf_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bgf00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BC1003_2878
   00640 Propanoate metabolism
    BC1003_2878
   00660 C5-Branched dibasic acid metabolism
    BC1003_2878
Enzymes [BR:bgf01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     BC1003_2878
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A ATP-grasp Cation_ATPase_N
Motif
Other DBs
NCBI-ProteinID: ADN58831
JGI: BC1003_2878
UniProt: E1T8R1
Position
1:complement(3362616..3363785)
Genome map
AA seq 389 aa AA seqDB search
MKIHEYQGKEILRKFGVAVPRGKPVFSVDDAVKAAEELGGPVWVVKAQIHAGGRGKGGGV
KVAKSLDQVREYANQILGMQLVTHQTGPEGQKVNRLLIEEGADIKKELYVGLVIDRVSQK
IVVMASSEGGMDVEEVAEKTPELIHKVAVDPSTGLKDAEADDLAKKIGVPDASIPQARAV
LQGLYKAFWETDASLAEINPLILTGDGKVIALDAKFNFDSNALFRHPEIVAYRDLDEEDP
AEVEASKFDLAYISLDGNIGCLVNGAGLAMATMDTIKLFGGEPANFLDVGGGATTEKVTE
AFKIMLKNPNLTAILVNIFGGIMRCDVIAEGVIAASKAVSLKVPLVVRMKGTNEDLGKKM
LAESGLPIISADSMEEAAQKVVAAAAGKA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaagattcacgagtaccagggtaaggaaatcctgcggaaattcggcgtcgcggtaccg
cgcggcaagccggtcttctcggtggatgatgcggtcaaggccgcggaagagctcggcggc
ccggtttgggtcgtgaaggctcagatccacgcgggtggccgtggcaagggtggcggcgtg
aaggttgccaagtcgctggaccaggttcgcgagtacgcgaaccagatcctcggcatgcag
ctcgtcacgcaccagaccggtccggaaggccagaaggtgaaccgtctgctgatcgaagaa
ggcgctgacatcaagaaggaactgtatgtcggcctcgtgatcgatcgcgtttcgcagaag
atcgtcgtgatggcctcgagcgaaggcggcatggacgtcgaagaagtcgcggaaaagacg
cccgagctgatccacaaggttgccgtcgacccgtcgaccggcctgaaggacgctgaagct
gacgacctcgcgaagaagatcggcgtgcccgacgcttcgattccgcaagcgcgcgccgtc
ctgcaaggcctctacaaggcgttctgggaaacggacgcgtcgctcgccgaaatcaacccg
ctgatcctgaccggcgacggcaaggtcatcgcgctcgacgccaagttcaacttcgactcg
aacgcgctgttccgtcatccggaaatcgtcgcgtatcgcgatctggacgaagaagatccg
gctgaagtggaagcgtcgaaattcgacctcgcgtacatctcgctcgacggcaacatcggc
tgtctggtgaacggcgcgggcctcgcaatggcgacgatggacaccatcaagctgttcggc
ggcgaacctgcgaacttcctcgacgtgggcggcggcgccacgacggagaaggtcacggaa
gccttcaagatcatgctgaagaacccgaacctgaccgcaattctggtcaacatcttcggc
ggcatcatgcgttgcgacgtgatcgcggaaggcgtgatcgctgcgtccaaggccgtgtcg
ctgaaggtgccgctcgtggtccgcatgaagggcaccaacgaagacctgggcaagaagatg
ctcgctgaatccggcctgccgatcatctcggccgacagcatggaagaagcggctcagaag
gtcgtcgcggctgctgcgggtaaggcgtaa

DBGET integrated database retrieval system