KEGG   Burkholderia sp. CCGE1003: BC1003_2904Help
Entry
BC1003_2904       CDS       T01314                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
bgf  Burkholderia sp. CCGE1003
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bgf00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    BC1003_2904
Enzymes [BR:bgf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     BC1003_2904
Exosome [BR:bgf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BC1003_2904
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:3389736..3391235
Genome map
AA seq 499 aa AA seqDB search
MQDQYILALDQGTTSSRAMLFDRLGNVVSTAQKEFEQIYPHPGWVEHDPQEIWSTQAGVA
AEAVTRAGMNGTSIAAIGITNQRETTIVWDRETGHPIYNAIVWQDRRTADFCDQLKAQGL
EEKVRAKTGLPIDSYFSATKIRWILDNVEGAREKARQGRLAFGTVDSWLVWNFTKGGLHV
TDVTNASRTMLFNIHTLTWDDELLDALDIPRSMLPEVRPSSEVYGPTKTTVFASKIPLAG
IAGDQHAALFGQMCTQSGMVKNTYGTGCFLVMNTGDKPIESKNNLVTTIAWQIGDQINYA
LEGSIFIGGAVVQWLRDGLGIIKNAAEIETLARGVPHCDGVYLVPAFAGLGAPHWNARAR
GTLFGVTRGTTSAHIARAALDSIAYQSLDVLKAMEADSGIRIGELRVDGGACANNLLMQF
QADILGVDAVRPKVSETTALGAAYLAGLAVGYWKDVDELQSQWKLDRRFTPALGQEDVNE
CLNGWKRAIRAAKAWADTP
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgcaggaccagtacatcctcgcgcttgaccagggcaccaccagttcacgtgcgatgctg
ttcgaccgcctcggcaatgtcgtgtcgacggcacaaaaggagtttgagcagatttatccg
catccgggctgggtcgagcacgatccgcaggagatctggtccacgcaagccggcgtggca
gcagaagcggtgacgcgcgcgggcatgaacggcacgtcgattgccgcgatcggcatcacg
aatcagcgcgagaccaccatcgtgtgggatcgcgaaaccggtcatcccatctacaacgcg
atcgtctggcaggaccgccgcaccgccgacttttgcgaccagctcaaggcgcagggcctc
gaagagaaagtgcgcgcgaaaaccggcttgccgatcgactcgtatttctcggccaccaag
atccgctggattctcgacaacgtggaaggcgcgcgtgaaaaagcccgtcagggtcgcctc
gcgttcggcacggtggacagctggctcgtgtggaatttcaccaagggcggcctgcacgtc
accgacgtgaccaacgcatcgcgcacgatgctcttcaacatccatacgctgacgtgggac
gacgaactgctcgacgcgctcgacattccacgcagcatgttgccggaggtccggccttcg
tcggaagtgtatgggccgaccaagacgaccgtgtttgcgtcgaagattccgctcgcgggc
attgccggcgatcagcatgccgcgctcttcggccagatgtgcacgcaatcgggcatggtg
aagaacacctacggcaccggctgctttctcgtgatgaacaccggcgacaagccgatcgaa
tcgaagaacaacctcgtcaccacgattgcgtggcagatcggcgaccagatcaattacgcg
ctggaaggcagcatcttcattggcggtgcagtggtgcaatggctgcgcgacggcctcggc
atcatcaagaacgcggctgaaatcgaaaccctggcgcgcggcgtgccgcattgcgacggc
gtctatctggtgcccgcgtttgctgggctgggcgctccgcattggaatgcgcgcgctcgc
ggcacgctgttcggcgtcacgcgcggcaccacgtccgcccatattgcccgcgccgcgctg
gattcgatcgcctaccagtcgctcgacgtgctcaaggcaatggaagccgactccggcatt
cgcatcggcgaactgcgcgtggacggcggcgcctgtgcgaacaacctgttgatgcagttc
caggccgacattctcggcgtggacgcggttcgcccgaaggtgtcggaaaccaccgcgctc
ggcgcggcgtatctggcgggccttgcggtgggctactggaaagatgtcgacgaactgcaa
agccagtggaagctcgaccggcgcttcacgcccgcgctcgggcaagaggacgtcaacgaa
tgtctgaacggctggaagcgcgcgattcgcgccgcgaaagcatgggccgacacgccctga

DBGET integrated database retrieval system