KEGG   Burkholderia sp. CCGE1003: BC1003_2973Help
Entry
BC1003_2973       CDS       T01314                                 

Definition
guanine-specific ribonuclease N1 and T1
Orthology
K01167  
ribonuclease T1 [EC:3.1.27.3]
Organism
bgf  Burkholderia sp. CCGE1003
Brite
Enzymes [BR:bgf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.27  Endoribonucleases producing 3'-phosphomonoesters
    3.1.27.3  ribonuclease T1
     BC1003_2973
Transfer RNA biogenesis [BR:bgf03016]
 Eukaryotic Type
  3'processing and CCA adding factors
   3'processing factor
    BC1003_2973
 Prokaryotic Type
    BC1003_2973
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(3470318..3470734)
Genome map
AA seq 138 aa AA seqDB search
MARRWQRMKGVLIGAIALCVSCGSVPDALARNSTAPAGTQAEAIGTVTVAQLPREAVDTL
NLIAAGGPYPYEKDGVVFGNRERLLPPNRRGYYHEYTVPTPRSRNRGARRIVCGGPLKRT
DNCYYSDDHYTSFNRIVE
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atggcacgcaggtggcagcgcatgaagggcgtgctgatcggtgctatcgcactgtgtgtt
tcatgcggctccgtgcccgacgcgctcgcgcgcaactccacggcacccgccggcacgcag
gccgaggcaataggcaccgtcacggtggcacaactgccccgtgaggcggtcgatacattg
aacttgatagctgcgggcgggccttacccgtatgaaaaggacggcgtcgtattcggcaac
cgcgaacggttgctgccgcccaaccggcgcggctactaccacgaatacaccgttcccacg
cctcgctcacgtaatcgcggggcacgtcgcatcgtctgcggaggtccgctgaagcgaacc
gacaattgttattactcggacgaccactacaccagttttaatcgtattgttgaatga

DBGET integrated database retrieval system