KEGG   Burkholderia sp. CCGE1003: BC1003_3080Help
Entry
BC1003_3080       CDS       T01314                                 

Definition
ribulose-phosphate 3-epimerase (EC:5.1.3.1)
Orthology
K01783  
ribulose-phosphate 3-epimerase [EC:5.1.3.1]
Organism
bgf  Burkholderia sp. CCGE1003
Pathway
Pentose phosphate pathway
Pentose and glucuronate interconversions
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:bgf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BC1003_3080
   01230 Biosynthesis of amino acids
    BC1003_3080
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BC1003_3080
   00040 Pentose and glucuronate interconversions
    BC1003_3080
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BC1003_3080
Enzymes [BR:bgf01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.1  ribulose-phosphate 3-epimerase
     BC1003_3080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:3595173..3595856
Genome map
AA seq 227 aa AA seqDB search
MTQFRIAPSILSADFARLGEEVRNVVAAGADWIHFDVMDNHYVPNLTIGPLVCEAIRPHV
DVPIDVHLMVRPVDRIVPDFAKAGANLISFHPEGSDHIDRTLSLIRDHGCKAGLVFNPAT
SLNYLDHVMDKLDLVLIMSVNPGFGGQSFIPEALNKLREARKRIDAYKERTGREIHLEVD
GGVKVDNIAEIAAAGADTFVAGSAIFGQPDHKVVIDKMRAALANIQH
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaattccgcatcgcccccagcattctgtccgccgacttcgcccgcctcggcgag
gaagtccgcaatgtcgtcgccgccggcgccgactggatccatttcgacgtgatggacaac
cattacgtgccgaacctcaccatcggcccgctcgtgtgcgaagcgattcgaccgcatgtg
gacgtgcctatcgacgtgcatctgatggtgcgcccggtcgatcgcatcgtgccggacttc
gcgaaggcgggcgcgaatctgatcagctttcaccccgagggctcggatcacatcgaccgt
acgctgtcgctgattcgcgatcacggctgcaaggccggcctggtgttcaacccggccacc
tcgctcaattatctggatcacgtgatggacaagctcgacctggtgctgatcatgtcggtg
aatcccggctttggcggccagtcgttcattcccgaagcgctcaacaagctgcgcgaagcc
cgtaagcggatcgacgcctataaggagcgcaccggccgcgagattcatctggaagtagac
ggcggcgtgaaggtcgacaacatcgcggaaattgccgcggcgggcgccgacacgttcgtg
gcaggttcggcgatcttcggccagccggaccacaaggtcgtgatcgacaagatgcgcgcc
gcgcttgccaacatccagcactga

DBGET integrated database retrieval system