KEGG   Burkholderia sp. CCGE1003: BC1003_3080Help
Entry
BC1003_3080       CDS       T01314                                 

Definition
ribulose-phosphate 3-epimerase (EC:5.1.3.1)
Orthology
K01783  
ribulose-phosphate 3-epimerase [EC:5.1.3.1]
Organism
bgf  Burkholderia sp. CCGE1003
Pathway
Pentose phosphate pathway
Pentose and glucuronate interconversions
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Class
Metabolism; Overview; Carbon metabolism [PATH:bgf01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:bgf01230]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:bgf00030]
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:bgf00040]
Metabolism; Energy metabolism; Carbon fixation in photosynthetic organisms [PATH:bgf00710]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:3595173..3595856
Genome map
AA seq 227 aa AA seqDB search
MTQFRIAPSILSADFARLGEEVRNVVAAGADWIHFDVMDNHYVPNLTIGPLVCEAIRPHV
DVPIDVHLMVRPVDRIVPDFAKAGANLISFHPEGSDHIDRTLSLIRDHGCKAGLVFNPAT
SLNYLDHVMDKLDLVLIMSVNPGFGGQSFIPEALNKLREARKRIDAYKERTGREIHLEVD
GGVKVDNIAEIAAAGADTFVAGSAIFGQPDHKVVIDKMRAALANIQH
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaattccgcatcgcccccagcattctgtccgccgacttcgcccgcctcggcgag
gaagtccgcaatgtcgtcgccgccggcgccgactggatccatttcgacgtgatggacaac
cattacgtgccgaacctcaccatcggcccgctcgtgtgcgaagcgattcgaccgcatgtg
gacgtgcctatcgacgtgcatctgatggtgcgcccggtcgatcgcatcgtgccggacttc
gcgaaggcgggcgcgaatctgatcagctttcaccccgagggctcggatcacatcgaccgt
acgctgtcgctgattcgcgatcacggctgcaaggccggcctggtgttcaacccggccacc
tcgctcaattatctggatcacgtgatggacaagctcgacctggtgctgatcatgtcggtg
aatcccggctttggcggccagtcgttcattcccgaagcgctcaacaagctgcgcgaagcc
cgtaagcggatcgacgcctataaggagcgcaccggccgcgagattcatctggaagtagac
ggcggcgtgaaggtcgacaacatcgcggaaattgccgcggcgggcgccgacacgttcgtg
gcaggttcggcgatcttcggccagccggaccacaaggtcgtgatcgacaagatgcgcgcc
gcgcttgccaacatccagcactga

DBGET integrated database retrieval system