KEGG   Burkholderia sp. CCGE1003: BC1003_3085Help
Entry
BC1003_3085       CDS       T01314                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
bgf  Burkholderia sp. CCGE1003
Pathway
bgf00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bgf01100  Metabolic pathways
bgf01110  Biosynthesis of secondary metabolites
bgf01130  Biosynthesis of antibiotics
bgf01230  Biosynthesis of amino acids
Module
bgf_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bgf00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BC1003_3085
Enzymes [BR:bgf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     BC1003_3085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ADN59034
JGI: BC1003_3085
UniProt: E1TA57
Position
1:3600141..3600938
Genome map
AA seq 265 aa AA seqDB search
MSDILDRIISVKREEVRAAEQSAPLEELRLEASSRDIRDFVGALRAKHAAGLAAVIAEVK
KASPSKGVLREDFVPAQIARSYEQHGAACLSVLTDVQFFQGSVAYLEQARAACQLPVLRK
DFIVDPYQIVEARAMGADAILLIAAALDTAQMQDLEALAHSLGLAVLVEVHDNDELQQAL
TLKTPLIGINNRNLRTFETSIETTIGMLEAIPDDRIVVTESGILSRADVERLRAKDVNTF
LVGEAFMRAEEPGVELARMFFPGAA
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacatcctcgaccgtatcatctcggtcaaacgcgaagaagtccgcgcggccgaa
caaagcgcgccgctcgaagaactccgcctcgaagcgtcgtcgcgcgacattcgcgatttc
gtcggcgcgttgcgcgcgaaacacgcggcggggctcgccgcggtgatcgccgaagtgaag
aaggcaagtccgtccaagggcgtgttgcgcgaagacttcgtgcctgcgcaaatcgcgcgt
tcgtatgaacagcacggcgcggcctgcctgtccgtgctgaccgatgtgcagttctttcag
ggcagcgtcgcgtatctcgaacaggcgcgcgccgcctgccagttgccggtgctgcgcaag
gacttcatcgtcgatccgtatcagattgtcgaagcccgtgcgatgggcgccgacgcgatc
ctgctgattgcagccgcgctcgacactgcgcagatgcaggacctcgaagcgctcgcgcac
tcgctgggcctcgccgtgctcgtcgaagtgcacgacaacgacgaactccagcaggcgctc
acgttgaaaacgccgctgatcggcatcaacaatcgcaatttgcgcaccttcgagacctcg
atcgaaacgacaatcggcatgctcgaagccattcccgacgaccgcatcgtggttaccgaa
tcgggcattctgtcgcgtgcggatgtcgagcggctgcgcgcgaaggacgtgaatacgttc
ctcgtcggcgaggcgttcatgcgtgccgaggagccgggcgtcgaacttgcccgcatgttc
tttcctggcgccgcgtga

DBGET integrated database retrieval system