KEGG   Burkholderia sp. CCGE1003: BC1003_3555Help
Entry
BC1003_3555       CDS       T01314                                 

Definition
D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
Orthology
K00058  
D-3-phosphoglycerate dehydrogenase [EC:1.1.1.95]
Organism
bgf  Burkholderia sp. CCGE1003
Pathway
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Serine biosynthesis, glycerate-3P => serine
Brite
KEGG Orthology (KO) [BR:bgf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BC1003_3555
   01230 Biosynthesis of amino acids
    BC1003_3555
  Energy metabolism
   00680 Methane metabolism
    BC1003_3555
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BC1003_3555
Enzymes [BR:bgf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.95  phosphoglycerate dehydrogenase
     BC1003_3555
Exosome [BR:bgf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BC1003_3555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(26662..27609)
Genome map
AA seq 315 aa AA seqDB search
MDTNVRKPVVLVTAADLAPQALERLDAFEVVFAGKQPTEDDIVALCERTKPVAIIVRYGK
INARIMDAAENLQVISKHGSGIDVIDQEAAAARGIAVRAAVGANAAAVAEHAWALILACA
KSVPQLDLRMRAGHWDKSTHKSFELDGGTLGVVGLGSIGRRVATIGVAFGMKVLAFDPFA
KEAPHGVTLASMEQIYAASDVLSLNCPLTDENRNMINRDTLSRMKRGAILVNTARGGLID
EAALVEALASGQLRSAGVDSFAVEPMTHPHPFQSVPNLILSPHVGGVSEAAYVNMGKGAA
ANVIAVIEESAHKLA
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atggacacgaatgttcgaaagccggtcgtgctcgtaacggccgccgacctcgcgccgcag
gcgctcgagaggctggatgcgttcgaagtcgtgttcgcgggcaagcaaccgaccgaggac
gacatcgtcgcgctgtgcgagcggacgaagcccgtcgcgatcatcgtccgttacggcaag
atcaacgcgcgcatcatggatgcagcggaaaacctgcaagtcatttcgaagcatggcagc
ggcatcgacgtgatcgatcaggaagccgccgctgcacgcggcatcgcagtgcgcgcggca
gtcggcgcgaacgccgcggcggtggccgagcacgcatgggcgctcattctcgcgtgcgcg
aagtcggtcccgcaactcgaccttcgcatgcgcgccggccactgggacaagtcgacgcac
aagtccttcgaactcgacggcggcacgctcggcgtagtcggcctcggttcgatcggaagg
cgcgtcgcgacgatcggcgtcgcgttcggcatgaaggtgctcgcgttcgatccgttcgcc
aaggaagcgccgcacggtgtgacgctcgcgtcgatggagcagatctacgccgcctccgac
gtgctctcgctgaactgtccgctgactgacgaaaaccgcaacatgatcaatcgcgatacg
ttgagccgcatgaagcggggcgcgattctcgtgaatacggcgcgcggcgggctgatcgat
gaagccgcgctcgtcgaggcgctcgcgagcggtcagttgcgctcggccggcgtcgacagc
tttgcggtcgagccgatgacgcatccgcatcctttccagtcagtgccgaacctgattctc
tcgccgcacgtcggcggcgtcagcgaagcggcctacgtgaacatgggcaagggggccgcg
gccaatgtgatcgcggtcatcgaggaaagcgcccacaagctggcgtga

DBGET integrated database retrieval system