KEGG   Burkholderia sp. CCGE1003: BC1003_3555Help
Entry
BC1003_3555       CDS       T01314                                 

Definition
(RefSeq) D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
  KO
K00058  
D-3-phosphoglycerate dehydrogenase [EC:1.1.1.95]
Organism
bgf  Burkholderia sp. CCGE1003
Pathway
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Serine biosynthesis, glycerate-3P => serine
Brite
KEGG Orthology (KO) [BR:bgf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BC1003_3555
   01230 Biosynthesis of amino acids
    BC1003_3555
  Energy metabolism
   00680 Methane metabolism
    BC1003_3555
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BC1003_3555
Enzymes [BR:bgf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.95  phosphoglycerate dehydrogenase
     BC1003_3555
Exosome [BR:bgf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BC1003_3555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(26662..27609)
Genome map
AA seq 315 aa AA seqDB search
MDTNVRKPVVLVTAADLAPQALERLDAFEVVFAGKQPTEDDIVALCERTKPVAIIVRYGK
INARIMDAAENLQVISKHGSGIDVIDQEAAAARGIAVRAAVGANAAAVAEHAWALILACA
KSVPQLDLRMRAGHWDKSTHKSFELDGGTLGVVGLGSIGRRVATIGVAFGMKVLAFDPFA
KEAPHGVTLASMEQIYAASDVLSLNCPLTDENRNMINRDTLSRMKRGAILVNTARGGLID
EAALVEALASGQLRSAGVDSFAVEPMTHPHPFQSVPNLILSPHVGGVSEAAYVNMGKGAA
ANVIAVIEESAHKLA
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atggacacgaatgttcgaaagccggtcgtgctcgtaacggccgccgacctcgcgccgcag
gcgctcgagaggctggatgcgttcgaagtcgtgttcgcgggcaagcaaccgaccgaggac
gacatcgtcgcgctgtgcgagcggacgaagcccgtcgcgatcatcgtccgttacggcaag
atcaacgcgcgcatcatggatgcagcggaaaacctgcaagtcatttcgaagcatggcagc
ggcatcgacgtgatcgatcaggaagccgccgctgcacgcggcatcgcagtgcgcgcggca
gtcggcgcgaacgccgcggcggtggccgagcacgcatgggcgctcattctcgcgtgcgcg
aagtcggtcccgcaactcgaccttcgcatgcgcgccggccactgggacaagtcgacgcac
aagtccttcgaactcgacggcggcacgctcggcgtagtcggcctcggttcgatcggaagg
cgcgtcgcgacgatcggcgtcgcgttcggcatgaaggtgctcgcgttcgatccgttcgcc
aaggaagcgccgcacggtgtgacgctcgcgtcgatggagcagatctacgccgcctccgac
gtgctctcgctgaactgtccgctgactgacgaaaaccgcaacatgatcaatcgcgatacg
ttgagccgcatgaagcggggcgcgattctcgtgaatacggcgcgcggcgggctgatcgat
gaagccgcgctcgtcgaggcgctcgcgagcggtcagttgcgctcggccggcgtcgacagc
tttgcggtcgagccgatgacgcatccgcatcctttccagtcagtgccgaacctgattctc
tcgccgcacgtcggcggcgtcagcgaagcggcctacgtgaacatgggcaagggggccgcg
gccaatgtgatcgcggtcatcgaggaaagcgcccacaagctggcgtga

DBGET integrated database retrieval system