KEGG   Burkholderia sp. CCGE1003: BC1003_3685Help
Entry
BC1003_3685       CDS       T01314                                 

Definition
phosphoketolase (EC:4.1.2.9)
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
bgf  Burkholderia sp. CCGE1003
Pathway
Pentose phosphate pathway
Carbon fixation in photosynthetic organisms
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:bgf00030]
Metabolism; Energy metabolism; Carbon fixation in photosynthetic organisms [PATH:bgf00710]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(177633..180026)
Genome map
AA seq 797 aa AA seqDB search
MAEAVSRPTPPQTLDPETLRNMDRYWRACNYLSAGMIYLLDNPLLREPLAPEHIKNRLLG
HWGSDPGQSFLLVHLNRLIKKLDLNMIYVSGPGHGAPATLANCYLEGHYSEIYPDRSEDE
AGMRRFFRQFSFPGGIGSHCTPETPGSIHEGGELGYSLSHGYGAAFDNPDLIVTVMIGDG
EAETGPLATSWHSNKFLNPVRDGAVLPVLHLNGYKIANPTVLARIPREELEALLTGYGHK
PYFVEGDEPESMHQQMAATLEQCIGEIRAIQQHARANNDATRPRWPMIVLRSPKGWTGPK
EVDGHKVEGSWRAHQVPIADPATNPASLALVEAWLRSYEPESLFDETGRLVEELRELAPK
GARRISANPHANGGVLCKMLDMPAFRDYAVEVKRPASTYSSPTQVLGTFLRDVMRRNMNN
FRVFGPDETASNKLTAIYEASDKTWLADSQPNDADGGALSPDGRVMEILSEHTLEGWFEG
YVLTGRHGLFATYEAFVHVIDSMFNQHAKWLEKAKRELGWRQPVPSINLLITSLVWRQDH
NGFTHQDPGFLDVVTNKSPDVVRIYLPPDANCLLSVADHCLRSRDYVNVIVSDKQPHLQY
LDMESAVTHCTKGIGIWEWASTDQGAEPDVVIACAGDIATMEALAAVQILKQHFADLKIR
FVNVVDLFRLMPEHAHPHGLSSRDFDSLFTTSKPVIFNFHSYASLVHKLTYNRTNHDNLH
VHGYHEKGNINTPLELAIINQVDRFSLAIDVIDRVPKLRGVGDHTKEWLRGQIIEHLAYA
HAEGIDKEEIRNWTWTD
NT seq 2394 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagcagtctcccgtcccaccccgccgcaaacgctggaccccgaaacgctgcgc
aacatggatcgctactggcgcgcgtgcaattacctgtccgccggcatgatctacctgctc
gacaacccgttgctgcgcgagccgctcgcgcccgagcacatcaagaatcgcctgttggga
cattggggctcggaccctggacagagcttcctgctcgtgcacctgaaccggctcatcaag
aagctcgatctcaacatgatctacgtgtcgggccccggacatggcgcgccggccacgctc
gcgaactgttatctcgaggggcattactcggaaatctaccctgaccgcagcgaagacgaa
gccggcatgcggcgctttttccggcaattctcgtttccgggcggcatcggttcgcactgc
acgccggaaacgccgggctccattcacgaaggcggtgaactgggctacagcctgtcgcac
ggctatggcgcggctttcgacaatcccgacctgatcgtcacggtgatgatcggcgacggc
gaggcggaaaccggtccgctcgccacctcgtggcattcgaacaagttcctcaacccggta
cgcgacggcgccgtgctgccggtgctgcatctgaacggctacaagatcgccaaccccacg
gtgctggcgcgcattccgcgtgaggaactggaggcgcttctcaccggttacggccataaa
ccgtattttgtcgaaggcgacgaaccagagtcgatgcatcagcagatggcggccacgctc
gaacaatgcatcggcgagatccgggcgatccagcagcatgcgcgtgcaaacaacgacgcc
acgcgcccgcgctggccgatgatcgtgctgcgctcgcccaaaggctggaccggccccaag
gaagtggacggccacaaggtggaaggctcatggcgcgcgcaccaggtgccgattgccgac
ccggcgaccaaccccgcgagtctcgcgctggtcgaggcgtggctgcgcagttacgagccc
gagtcgctgttcgacgaaaccgggcggcttgtcgaggagttgcgcgaactcgcgccaaag
ggcgcacgccgcatcagcgcgaatccgcatgcgaacggcggggtgctgtgcaagatgctg
gacatgcccgcgtttcgcgactatgcggtcgaggtgaagcggccggcgtccacatactcg
tcgccgactcaggtgctcggcacgttcttgcgcgacgtgatgcgcaggaacatgaacaac
tttcgcgtgttcgggcccgacgaaacggcaagcaacaagctcacggccatctacgaagcc
tcggacaagacctggctggccgactcgcagccgaacgacgccgacggcggcgcgctgtcg
cccgacggtcgcgtgatggaaatactgagcgaacacacgctggaaggctggttcgaaggt
tacgtgctgaccggccggcacggcctttttgccacttacgaagccttcgtgcatgtgatc
gattcgatgttcaaccagcacgccaagtggctcgaaaaagccaagcgcgaactgggttgg
cgccagcccgtgccgtcgattaacctgctgatcacgtcgcttgtctggcgtcaggaccac
aatggtttcacgcatcaggaccccggttttctcgacgtggtgaccaacaagagtcccgac
gtagtgcgtatttatctgccgcccgacgcgaactgcctgttgagcgtggccgatcactgc
ctgcgctcgcgcgactacgtgaacgtgatcgtgtcggacaagcagccgcatttgcagtat
ctcgacatggagtcggccgtcacgcattgcaccaagggcatcggcatctgggagtgggcg
tccaccgaccagggcgccgagccggacgtggtgatcgcctgcgcgggcgacattgcgacc
atggaagcgctcgccgccgtgcagattctcaagcagcactttgccgatctgaagatccgc
tttgtcaatgtggtggacctgttccgcttgatgccggagcatgcgcatccgcatggactg
tcgagccgcgacttcgattcgttgttcaccaccagcaagccggtgatcttcaatttccat
tcgtatgcgtcgctggttcacaagctgacctataaccgcaccaatcacgacaatctgcat
gtgcatggctatcacgagaagggcaacatcaatacgccgctcgaactcgcgatcatcaac
caggtggaccgcttttctctggctatcgacgtgatcgaccgcgtgccgaagctgcgcggc
gtcggcgatcacacgaaggagtggctgcgcgggcagatcatcgagcatctcgcctatgcg
catgccgagggcatcgacaaggaagagatccgcaactggacgtggactgactga

DBGET integrated database retrieval system