KEGG   Burkholderia sp. CCGE1003: BC1003_3859Help
Entry
BC1003_3859       CDS       T01314                                 

Definition
(GenBank) hypothetical protein
  KO
K03928  carboxylesterase [EC:3.1.1.1]
Organism
bgf  Burkholderia sp. CCGE1003
Brite
Enzymes [BR:bgf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     BC1003_3859
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_6 Abhydrolase_1 Abhydrolase_3 DUF676
Motif
Other DBs
NCBI-ProteinID: ADN59798
JGI: BC1003_3859
UniProt: E1TJQ1
Position
2:386354..387244
Genome map
AA seq 296 aa AA seqDB search
MTDMNATPFSSTDGSDHVVLLLHGLSSSPLELRFLARLLADEGFATHTPELPGYSAGTGH
LPMEQWIDAAIAEFDKLAAQYQHVSICGLSMGATLAAAVAHERPAARALLLLSITLNYDG
WSLPWYRFLLDYAYYTPLRSRYRYREQEPYGLRNEALRSKIARAMQKNDISEVGPAFIGM
PALHEAGRLAASVKKKLKGIGTDCLIIHAIDDETSSPHNARFVGTNIGASFLRTIWLDDS
YHMITSDNEREVVARECALFLRESVAATVSSHNPAPVVSRALARRLRQLATVARKA
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgactgacatgaacgccacacccttttcaagcactgacggcagcgatcacgtcgtgctg
ttgttgcacggcctctcgagctcgccgctcgagctgcgctttctcgcacgactgcttgcc
gacgagggctttgctacccatacgccggaattgcccggctacagcgctggcacgggacac
ctgccgatggagcaatggatcgacgcggccatcgcggagttcgacaaactcgccgcacag
tatcagcacgtctcgatatgcggcctgtcgatgggcgcgacgctcgcggctgccgtcgcg
cacgagcggcccgccgcccgcgcgctgctgctgctatccatcacgctgaactacgacggc
tggtcgcttccgtggtatcgcttcttgctggactatgcgtactacacgccgcttcgctcg
cgctatcgctatcgtgaacaggaaccctacgggctgcgcaacgaagcgttgcgctcgaag
atcgcgcgagccatgcagaagaacgacatcagcgaagtcggacccgcattcatcggcatg
ccggcgctgcacgaagccggccgcctcgcggcatcggtaaagaagaagctcaagggcatc
ggaaccgattgcctgattattcacgctatcgacgacgagacctcgagcccgcataacgcg
cgcttcgtggggaccaacatcggcgcttcgttcttgcgaaccatctggcttgacgactcc
tatcacatgatcacttccgacaacgagcgcgaagtcgtggcgcgcgaatgtgcgctcttc
ctgcgcgaaagcgtggcggcaacggtgtccagccataacccggcgccggtggtttcgcga
gcgcttgcgcgccgcctgcggcaactggcgactgtggcgaggaaagcatga

DBGET integrated database retrieval system