KEGG   Burkholderia sp. CCGE1003: BC1003_4098Help
Entry
BC1003_4098       CDS       T01314                                 

Definition
(GenBank) Cellulase
  KO
K20542  endoglucanase [EC:3.2.1.4]
Organism
bgf  Burkholderia sp. CCGE1003
Brite
Enzymes [BR:bgf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     BC1003_4098
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_8
Motif
Other DBs
NCBI-ProteinID: ADN60034
JGI: BC1003_4098
UniProt: E1TDT2
Position
2:643648..644841
Genome map
AA seq 397 aa AA seqDB search
MRFRINRKQGLALALGLTLGLTASAGFARLVKAAQPAAAPGACGDWSGYRTFVERFVQAD
GRVIDYSTPTQQTTSEGQSYGLFFALVANDRATFDRLLNWTRMNLAGNQFDPQNVRLPAW
LWGRKADGSYGVLDPNSASDSDLWIAYDLLQAGRLWHEPAYTQLGQALAARIARDEMTNL
PGVGPMLLPGPQGFKDGGVTRLNPSYLPLPVLRALAQELPNGPWAKLAESAYRLIRTTAP
QGFAPDWAAWQNGQFVVDPKSGDTGSYDAIRVYLWAGLAAPADPLAKPWLAALGGMRARV
AQNGFPPEKVSSTSGNASGEGPLSYWGALAPYFKAQGDAHGLGLARTHLAALDASVPGHE
PVYYDRVLGLFGTGFIDGRYRFDESGRLVPNWRNACD
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgcggtttcgaatcaacaggaaacagggcctcgcgctggcgctcggcctgactttggga
ctcacggcatcggcgggtttcgcgcggctcgtcaaggctgcgcagccggctgccgcgccg
ggcgcctgcggcgactggagcggctatcgcactttcgtcgaacgcttcgtgcaggccgac
ggccgcgtgatcgactactcgacgccgacccagcagaccacctcggaaggccagtcgtac
ggcctcttcttcgccctcgtcgcgaacgatcgcgcgaccttcgaccggctcctgaactgg
acgcgcatgaacctcgcgggcaatcagttcgatccgcagaacgtgcgcctgccggcctgg
ctatggggcaggaaggcggacggctcgtacggcgtgctggatcctaattcggcttccgac
tccgacctgtggatcgcctacgacctgctgcaagccggacggctgtggcacgagcccgct
tacacgcaactcggccaggcactcgcggcccgcatcgcgcgcgacgagatgaccaacctg
ccgggtgtcggtcccatgctgctgcccggaccgcaaggcttcaaggacggcggcgtcacg
cggctcaatccgagctatctgccgctgcccgtgctgcgcgcacttgcgcaggaattgccc
aacggcccgtgggcgaagctcgccgagagcgcctacagattgatcaggaccactgcgccg
caaggcttcgcgcccgactgggccgcgtggcagaacggccagttcgtggtcgatccgaaa
agcggcgacaccggcagctatgacgcgatccgcgtctatctgtgggccggcctcgcggcg
cccgccgatccgctcgcgaagccgtggctcgcggcgctcggcggcatgcgcgcgcgcgtc
gcgcaaaacggctttccgcccgagaaagtatcgtcgaccagcggcaacgcaagcggcgaa
ggtccgctcagctactggggcgcgctcgcgccgtacttcaaggcgcaaggcgacgcgcac
gggctcggcctcgcgcgcacgcacctggccgcgctggacgcgagcgtgccgggccatgag
ccggtgtactacgacagggtgctgggcctgttcggcacgggtttcatcgacgggcgctat
cgctttgacgaaagcggccgtctcgtgccgaactggagaaacgcatgcgactga

DBGET integrated database retrieval system