KEGG   Burkholderia sp. CCGE1003: BC1003_4098Help
Entry
BC1003_4098       CDS       T01314                                 

Definition
(GenBank) Cellulase (EC:3.2.1.4)
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
bgf  Burkholderia sp. CCGE1003
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2:643648..644841
Genome map
AA seq 397 aa AA seqDB search
MRFRINRKQGLALALGLTLGLTASAGFARLVKAAQPAAAPGACGDWSGYRTFVERFVQAD
GRVIDYSTPTQQTTSEGQSYGLFFALVANDRATFDRLLNWTRMNLAGNQFDPQNVRLPAW
LWGRKADGSYGVLDPNSASDSDLWIAYDLLQAGRLWHEPAYTQLGQALAARIARDEMTNL
PGVGPMLLPGPQGFKDGGVTRLNPSYLPLPVLRALAQELPNGPWAKLAESAYRLIRTTAP
QGFAPDWAAWQNGQFVVDPKSGDTGSYDAIRVYLWAGLAAPADPLAKPWLAALGGMRARV
AQNGFPPEKVSSTSGNASGEGPLSYWGALAPYFKAQGDAHGLGLARTHLAALDASVPGHE
PVYYDRVLGLFGTGFIDGRYRFDESGRLVPNWRNACD
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgcggtttcgaatcaacaggaaacagggcctcgcgctggcgctcggcctgactttggga
ctcacggcatcggcgggtttcgcgcggctcgtcaaggctgcgcagccggctgccgcgccg
ggcgcctgcggcgactggagcggctatcgcactttcgtcgaacgcttcgtgcaggccgac
ggccgcgtgatcgactactcgacgccgacccagcagaccacctcggaaggccagtcgtac
ggcctcttcttcgccctcgtcgcgaacgatcgcgcgaccttcgaccggctcctgaactgg
acgcgcatgaacctcgcgggcaatcagttcgatccgcagaacgtgcgcctgccggcctgg
ctatggggcaggaaggcggacggctcgtacggcgtgctggatcctaattcggcttccgac
tccgacctgtggatcgcctacgacctgctgcaagccggacggctgtggcacgagcccgct
tacacgcaactcggccaggcactcgcggcccgcatcgcgcgcgacgagatgaccaacctg
ccgggtgtcggtcccatgctgctgcccggaccgcaaggcttcaaggacggcggcgtcacg
cggctcaatccgagctatctgccgctgcccgtgctgcgcgcacttgcgcaggaattgccc
aacggcccgtgggcgaagctcgccgagagcgcctacagattgatcaggaccactgcgccg
caaggcttcgcgcccgactgggccgcgtggcagaacggccagttcgtggtcgatccgaaa
agcggcgacaccggcagctatgacgcgatccgcgtctatctgtgggccggcctcgcggcg
cccgccgatccgctcgcgaagccgtggctcgcggcgctcggcggcatgcgcgcgcgcgtc
gcgcaaaacggctttccgcccgagaaagtatcgtcgaccagcggcaacgcaagcggcgaa
ggtccgctcagctactggggcgcgctcgcgccgtacttcaaggcgcaaggcgacgcgcac
gggctcggcctcgcgcgcacgcacctggccgcgctggacgcgagcgtgccgggccatgag
ccggtgtactacgacagggtgctgggcctgttcggcacgggtttcatcgacgggcgctat
cgctttgacgaaagcggccgtctcgtgccgaactggagaaacgcatgcgactga

DBGET integrated database retrieval system