KEGG   Burkholderia sp. CCGE1003: BC1003_4496Help
Entry
BC1003_4496       CDS       T01314                                 

Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
bgf  Burkholderia sp. CCGE1003
Pathway
bgf00020  Citrate cycle (TCA cycle)
bgf00190  Oxidative phosphorylation
bgf00650  Butanoate metabolism
bgf01100  Metabolic pathways
bgf01110  Biosynthesis of secondary metabolites
bgf01120  Microbial metabolism in diverse environments
bgf01130  Biosynthesis of antibiotics
bgf01200  Carbon metabolism
Module
bgf_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bgf_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bgf_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bgf00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BC1003_4496
   00650 Butanoate metabolism
    BC1003_4496
  Energy metabolism
   00190 Oxidative phosphorylation
    BC1003_4496
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt
Motif
Other DBs
NCBI-ProteinID: ADN60428
JGI: BC1003_4496
UniProt: E1TG01
Position
2:1115756..1116124
Genome map
AA seq 122 aa AA seqDB search
MAAPNRIGSKRLVVGAHYGLRDWLAQRLTACVMAIYTVILLAWFFGARDFSYEGWASIFA
TQWMKLATFVTLLSLFYHAWVGIRDIWMDYVKPVGTRLLLQALTIVWLLACAGYAAQILW
RV
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggcagcccctaaccgaatcggctcgaagcgccttgtcgtcggcgcgcactacggtctg
cgcgactggctcgcgcaacgcctcaccgcctgcgtgatggccatctacacggtgatcctg
ctcgcgtggttcttcggcgcacgcgatttctcctacgaaggctgggcctcgatcttcgcc
acccagtggatgaagctcgccaccttcgttacgctgctctcactcttctatcacgcgtgg
gtcggcatccgcgacatctggatggactatgtgaagcccgtgggcacgcgtctgctgctg
caggcgctgacgatcgtctggctgctcgcgtgcgcgggctacgctgcgcagattctctgg
agagtgtaa

DBGET integrated database retrieval system