KEGG   Burkholderia sp. CCGE1003: BC1003_4514Help
Entry
BC1003_4514       CDS       T01314                                 

Definition
hopanoid-associated sugar epimerase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
bgf  Burkholderia sp. CCGE1003
Brite
Enzymes [BR:bgf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     BC1003_4514
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:1132237..1133247
Genome map
AA seq 336 aa AA seqDB search
MTEQNRDLVLVTGASGFVGSSVARIAQQKGFKVRVLVRATSPRQNVESLDAEIVIGDMRD
EASMRNALRGVRYLLHVAADYRLWAPDPGEIERSNLEGTEATMRAALKEGVERIVYTSSV
ATLKVTSSGNSADETSPLKADQAIGVYKRSKVLAERAVERMIAQDGLPAVIVNPSTPIGP
RDVKPTPTGRIIVEAALGKIPAFVDTGLNLVHVDDVAAGHFLALERGKIGERYILGGENL
PLQQMLADIAALTGRKAPTISLPRWPLYPLAMGAEALAKFTKREPFVTVDGLKMSKNKMY
FSSAKAERELGYRARPYREGLSDALEWFRQAGYLKP
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaacagaatcgcgatctcgtgctcgtgaccggcgcatccggcttcgtcggctcg
tcggtcgcgcgcatcgcgcaacagaagggcttcaaggtgcgggtgctggtgcgcgccacc
agtccacggcagaacgtcgagtcgctcgacgccgaaatcgtgatcggcgacatgcgcgac
gaagcgtcgatgcgcaacgcgctgcgcggcgtgcgctatctgctgcacgtcgccgccgac
taccggctgtgggcgcccgacccaggcgagatagagcgctcgaacctcgaaggcaccgag
gcgaccatgcgcgccgcgttgaaggaaggcgtcgagcggatcgtgtacaccagcagcgtg
gccacgctcaaggtcacgagctccggcaactcggccgacgagacatcgccgctgaaggcc
gatcaggccatcggcgtatacaagcgcagcaaggtgctggccgagcgcgcggtggaacgc
atgatcgcgcaggacggcctgccggcggtgatcgtcaatccgtccacgccgatcggtccg
cgcgacgtcaagccgacgccgaccgggcgcatcatcgtcgaggcggcgctcggcaagatt
cccgccttcgtcgacacggggctgaacctcgtgcatgtagacgacgtcgccgccgggcat
tttctcgcgctcgagcgcggcaagatcggcgaacgctatattctcggcggcgaaaacctg
ccgctgcagcaaatgctcgcggatatcgccgcgctcaccggccgcaaggcgccgaccatc
agcctgccgcgctggccgctatacccgctcgccatgggcgcggaagcgctcgccaagttc
acgaagcgcgaaccgttcgtaaccgtggacggtctgaagatgtcgaagaacaagatgtac
ttcagttcggccaaagccgagcgcgagttgggctaccgcgcgcgtccgtatcgcgagggt
ttgagcgatgcgctcgaatggttccggcaggcaggctatctgaagccttag

DBGET integrated database retrieval system