KEGG   Burkholderia sp. CCGE1003: BC1003_4576Help
Entry
BC1003_4576       CDS       T01314                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
bgf  Burkholderia sp. CCGE1003
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bgf00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BC1003_4576
Enzymes [BR:bgf01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     BC1003_4576
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:1210350..1212560
Genome map
AA seq 736 aa AA seqDB search
MSTRRSGDTIATLATRAGFEVEWEDAHRKVHRVPEKTLAILLERMGLPCGNATQIRQSAA
ALDAELSGRKLPPLMTAQVGRGIALPAAALKSGSHYRIELESGSIIDGRFTAPKGEEALL
APIDEPGYHTLVIHEQRVTLAVAPSRCYTVADAWRSLRDDERAVAPPLWGVATQLYGLRR
VGDGGIGDYSALAQIAAESAKRGAHALAVSPTHAMFSAEPNRFSPYSPSSRLWLNVTHID
PAAVFGEAAARAAMQSADAVDAWSELEGLPLIDWPKAVVLKLKVLRALFENFCTHERARE
GAEDTPRALEFHGFCERAGRALEDHARFEALQAAQLAQGGNGHWRNWPEALRDPRSPEVE
AFAQAHRHEVDFHLFLQWLAAKGLSHAQYAAREAGMAVGLIADLAVGCDSAGSHAWSYRD
DMLQGVSVGAPPDLFNQAGQSWGLTTFSPRAMRTQGFSAFIDMLRAAFAHAGGIRIDHIL
GLRRLWLVPEGESASNGAYLRYPLEDLLRLIALESWRHRAIVIGEDLGTVPPGFRERLDE
HGIAGIRVLWFERGEDGTGFKPPQAWDRNAVGTTTTHDLPTVAGWWAGSDITWRNRIGQT
MARPDGRDPEEAAQEERASDRAELWQAFQQAGVAPPDVEAPPTDNAPVDEALAFVAATPG
PLVTFPLEDLLAQSDQPNLPGSIDEHPNWRRRMNLPIDEMFLDDTFCDRLLAVDRARSAA
TVSTPSANPASEPDTP
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
gtgagtacccgacgttccggcgacacgatcgccacgctggcaacacgcgccggtttcgag
gtggagtgggaagacgcgcatcgcaaggtgcatcgcgtgcccgagaaaaccctcgcgatt
ctgctcgaacgaatgggtctgccatgcggtaacgccacgcaaatccgtcaaagtgcggcc
gcgctcgacgcggaattgtccggccgcaagctgccgccgctgatgaccgcacaggtcggg
cgcggcattgcgttgcccgccgcggcgctgaagtcgggcagccattaccggatcgagctg
gagagcggttcgattatcgacgggcgctttacggcgcccaaaggcgaagaggcgttgctc
gcgcccatcgacgaacccggctatcacacgctcgtaattcatgagcagcgcgtgacgctc
gcggttgcgccgtcgcgctgctacaccgtggccgacgcgtggcgcagtctgcgcgacgac
gagcgcgccgtggctccgccgttgtggggcgtggccacgcagctttacggcttgcgccgg
gtgggcgatggcggcattggcgattattcggcactcgcacaaatcgcagcggaaagcgcg
aagcgcggcgcgcatgcgctggccgtcagtccgacccacgccatgttcagcgcggagcca
aaccgctttagtccctattcgccgtcttcgcgcttgtggttgaacgtcacgcatatcgac
ccggctgccgtgttcggcgaagcagccgcgcgcgccgcaatgcagtccgccgacgccgtg
gacgcatggtccgagctggaaggcttgccgctcatcgactggccgaaggccgtggtgctc
aaactgaaagtcttgcgcgcgctctttgaaaatttctgcacgcacgagcgcgcgcgcgag
ggcgcggaagacaccccgcgcgcgctggaattccacggtttctgcgagcgcgcggggcgc
gccctggaagatcatgcgcgtttcgaagcgctgcaagccgcgcaactcgcgcaaggcggc
aatggtcactggcgcaactggcctgaagcattgcgcgatccgcgcagcccggaggtggag
gcattcgcgcaagcacatcgtcacgaggtcgactttcatctctttctgcaatggcttgcc
gcgaaaggtctctcgcatgcgcaatatgcggcgcgcgaagcgggcatggccgtgggcctg
attgccgacctcgcggtgggatgcgacagcgccggcagccacgcatggtcctatcgcgac
gacatgttgcaaggtgtgtccgtcggcgcgccgcccgacctcttcaaccaggcgggacaa
agctggggtctcaccacgttctcgccgcgcgcaatgcgcacgcaaggcttttccgcattc
atcgacatgctgcgcgccgcgttcgcgcatgcgggcggcatccgtatcgatcacattctc
ggcttgcggcgcctgtggctcgtgccggaaggcgaaagcgcgagcaacggcgcatatctg
cgctatccgctcgaagacctgttgcggctcatcgcgctcgaatcgtggcggcatcgcgcg
attgtaatcggcgaggacctcggcacggtgccgccaggttttcgcgagcggctcgacgag
cacggcattgccggcatccgcgtgctgtggttcgagcgcggcgaggacggcactggcttc
aagccaccgcaagcatgggaccgcaatgcggtcggcacgaccacgacgcacgatctgccg
acagtcgccggctggtgggcgggcagcgacattacatggcgcaaccggatcggccagacg
atggcccggcccgatggccgcgatcccgaagaagccgcccaggaagaacgtgcgagcgac
cgcgccgagctatggcaggcattccagcaagccggcgtggctccacccgacgtcgaggcg
ccgcccaccgacaacgcgccggtggacgaagcgctcgccttcgtcgcggcaacgcccggg
ccgctcgtcacctttccgctcgaagacctgctcgcgcaaagcgaccagccgaacctgccg
ggctcgatcgacgagcatccgaactggcgccgccgcatgaacctgcccatcgacgaaatg
tttctcgacgacaccttttgcgaccggctgctcgccgttgaccgcgcgcgcagcgccgcg
accgtttccactccttcagccaatcctgcttcggagcctgatacgccatga

DBGET integrated database retrieval system