KEGG   Burkholderia sp. CCGE1003: BC1003_4587Help
Entry
BC1003_4587       CDS       T01314                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bgf  Burkholderia sp. CCGE1003
Pathway
bgf00260  Glycine, serine and threonine metabolism
bgf00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bgf01100  Metabolic pathways
bgf01110  Biosynthesis of secondary metabolites
bgf01130  Biosynthesis of antibiotics
bgf01230  Biosynthesis of amino acids
Module
bgf_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bgf00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BC1003_4587
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BC1003_4587
Enzymes [BR:bgf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BC1003_4587
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA Peripla_BP_6 PcrB His_biosynth KDGP_aldolase BtpA
Motif
Other DBs
NCBI-ProteinID: ADN60519
JGI: BC1003_4587
UniProt: E1TGN2
Position
2:complement(1225144..1225956)
Genome map
AA seq 270 aa AA seqDB search
MSRIKNTFAALSEQGKKGLIPFMTAGDPDPARTVEFMHALAAGGADVIELGVPFSDPMAD
GPVIQQSSERALAHGVSLRHVMADVKRFRETNDTTPVVLMGYANPIERMGTEAFAQAAKE
AGVDGVLVVDYPPEECANFAEKMRAAGIDPIFLLAPTSTDERIAEVGKIASGYVYYVSLK
GVTGAANLDVSSIASKIPAIKSRVPLPVGVGFGIRDAETARLVAEVSDAVVIGSRIVQLL
EQAAPETAAETLTRFVAEVREALDSVATAR
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgtatcaaaaacacattcgctgcgctgtccgagcagggcaaaaaaggcctgatt
cctttcatgacggccggcgaccccgacccagcccgcacggtcgaattcatgcacgcgctg
gctgcgggcggcgccgacgtcattgaactcggcgtgccgttttccgacccgatggccgac
ggcccggtcatccagcaatcgtccgagcgggcgttggcacacggcgtgtcgttgcgtcac
gtgatggcagacgtcaagcggttccgcgaaaccaacgacaccacgcctgtcgtgctgatg
ggctacgccaacccgatcgagcgcatgggcaccgaagccttcgcgcaggcggcgaaggaa
gccggcgtggacggcgtgctcgtggtcgactacccgccggaagaatgcgcgaatttcgcc
gaaaagatgcgtgcggccggcatcgacccgatcttcctgctggcgcccacctccaccgac
gagcgtattgccgaagtcggcaagatcgcgagtggttatgtgtattacgtgtcgctaaaa
ggggtgaccggagcggcaaatctggacgtttccagcatcgcgagtaaaatcccggcgatc
aagtcgcgcgtgcccctgccggtgggcgtcggttttggcattcgtgacgccgaaacggcc
cgcctcgtggccgaagtttccgacgccgtcgtgatcggcagccgtatcgtgcaattgctc
gagcaggccgccccggaaactgccgctgagacgctcacgcgtttcgtcgccgaggtgcgc
gaggcgctcgatagcgtcgcgactgcccgataa

DBGET integrated database retrieval system