KEGG   Burkholderia sp. CCGE1003: BC1003_4739Help
Entry
BC1003_4739       CDS       T01314                                 

Definition
1-phosphofructokinase (EC:2.7.1.11)
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
bgf  Burkholderia sp. CCGE1003
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bgf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BC1003_4739
   01230 Biosynthesis of amino acids
    BC1003_4739
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BC1003_4739
   00030 Pentose phosphate pathway
    BC1003_4739
   00051 Fructose and mannose metabolism
    BC1003_4739
   00052 Galactose metabolism
    BC1003_4739
  Energy metabolism
   00680 Methane metabolism
    BC1003_4739
Enzymes [BR:bgf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BC1003_4739
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:1417503..1418435
Genome map
AA seq 310 aa AA seqDB search
MPQIVTITLNPAVDVATSVDRVTDTRKLRCSPARRDPGGGGINVARVIQRLGGDCSAIYL
AGGATGQMLRELLDAEAFVGVGIEIAGETRENFSVLEQSTGHEYRFVLPGPTLGALDWQR
CLDEFNALEVAPRYLVMSGSLPPGAATSTYAQLTRIASARGTRVVVDTSGPALAEALNAG
VWIVKPSLRELQDLTGQPLLEEPECIAVARDIVRSGRAQIVAVTLGERGALLVTAEHCLR
AAGLPVKVCSSIGAGDSFLAALVWALNRNADIDEAFRYGMAAASATLLGAGTTLCERGEV
ERLYREISIR
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgccgcagatcgtcacgatcacgctcaatcccgccgtcgacgtagcaacatcggtcgac
cgggtgaccgatacccgcaagctgcggtgcagccccgcacggcgcgatcctgggggcgga
ggaatcaacgtcgctcgcgtcatacagcgtcttggcggagactgctccgctatatatctc
gcgggcggagcaaccggtcaaatgctgcgagaactgctcgacgctgaggcattcgtcgga
gtcggcatcgagatcgcgggggagacgcgggaaaatttctccgtgctcgagcaatccacc
ggacatgaataccgcttcgtgctgccgggtccgacgctcggcgcgctggactggcagcgc
tgccttgatgagttcaatgcgctagaggttgcgccccgttatctcgtgatgagcggcagc
ctgcctccaggcgcggcgaccagcacctacgcgcaactgactcgaatcgcgagcgcgcgc
ggcacgcgagtcgtggttgacacatcaggccctgcgcttgccgaggcgctcaacgcgggt
gtctggatcgtcaagccgagcctgagagagctgcaggatcttacggggcagccgctgctc
gaggagcccgaatgcattgctgtagcccgggacatagtgcgctccgggcgcgctcagata
gtcgcggtgacgctcggcgaacgcggcgcactgctggtcactgcagaacactgcttgcgt
gcagccgggctgccggtgaaagtgtgcagttcgattggcgccggcgacagcttcttagct
gcgctcgtctgggccctgaatcgcaacgcggatatcgatgaagcgttccgctacggcatg
gcggctgcatcggcgactttgctcggcgcaggcacgaccctttgcgagcgcggggaggtc
gaacggctctatcgcgagatatctatccgatga

DBGET integrated database retrieval system