KEGG   Burkholderia sp. CCGE1003: BC1003_4927Help
Entry
BC1003_4927       CDS       T01314                                 

Definition
(GenBank) iron-containing alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
bgf  Burkholderia sp. CCGE1003
Pathway
bgf00010  Glycolysis / Gluconeogenesis
bgf00071  Fatty acid degradation
bgf00350  Tyrosine metabolism
bgf00625  Chloroalkane and chloroalkene degradation
bgf00626  Naphthalene degradation
bgf01100  Metabolic pathways
bgf01110  Biosynthesis of secondary metabolites
bgf01120  Microbial metabolism in diverse environments
bgf01130  Biosynthesis of antibiotics
bgf01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bgf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BC1003_4927
  Lipid metabolism
   00071 Fatty acid degradation
    BC1003_4927
  Amino acid metabolism
   00350 Tyrosine metabolism
    BC1003_4927
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BC1003_4927
   00626 Naphthalene degradation
    BC1003_4927
Enzymes [BR:bgf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BC1003_4927
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: ADN60850
JGI: BC1003_4927
UniProt: E1TJ34
Position
2:complement(1618029..1619192)
Genome map
AA seq 387 aa AA seqDB search
MTNVFRFQTVPTLVVEFGAARRLGALLRAQFPALDRICVVTDGFLHQSGLLAPALADLAA
HGWQASVIDDVIADPPEHVVLEATARARGASAEIVLGLGGGSSMDVAKLIAVLAAQQEQA
LGDMYGVNKITVSRLPLVQMPTTAGTGSEVTAVSIVTVGEAKKMGVVAPQLIADLAILDA
ELTLGLPVAATAATGIDAMVHAIEAFTSAHLKNPISDMLAIKALELLSRNLLPACQDGSN
RAAREAMLLGATFAGQAFANSPVAAVHALAYPIGGIYHVPHGLSNALVLPHVLRFNAEAA
AHLYAELAEVVVPGVTGDVENRTRALIDKLEEMIAATGIPARLRDVGIPPDGLPGMASDA
MLQTRLLVNNPRPVSENDALAIYQAAF
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgacgaacgtattccgctttcaaacagtgccgacgctcgtcgtcgaattcggcgcggcg
cgtcggctgggcgcgctgttgcgcgcgcagtttccggcgcttgaccgtatatgcgtggtc
acggacggctttttgcaccagagcgggttgctggcccccgcccttgccgatctggcggcg
cacggctggcaagcgagcgtgattgacgacgtgatcgccgatccccccgagcacgtggta
cttgaagcgacagcccgggcgcgcggcgccagcgccgagatcgtgctcgggctgggcggc
gggtcgtcaatggacgtggccaagctgatcgcggtgctcgctgcgcagcaggagcaggcg
ctcggcgacatgtatggcgtcaacaagatcaccgtgtcgcgcttgccgctcgtgcagatg
ccgacaaccgccgggaccgggtccgaagtgacggctgtgtcgattgtcacggtcggcgag
gcaaagaaaatgggcgtggtcgcgccgcaactgatcgccgacctcgccattctcgatgcc
gaactgacgctcgggctgccggttgccgcaacggcggcgacgggtatcgacgccatggtt
cacgctatcgaagcgttcacgtccgcgcacctgaaaaatccgatctccgacatgctcgcg
ataaaggcgctcgaactgctgtcgcgcaacctgctgcccgcctgccaggacggcagcaac
cgcgcggcgcgtgaggcgatgctgctaggcgcaacgttcgcgggacaggcgttcgcgaac
tcgccggtggcggccgtgcatgcgctcgcgtatccgattggcggcatttaccacgtgccg
cacgggctttcgaacgcgctcgtgctgccgcatgtgttgcgtttcaacgctgaagcggca
gcccatctgtatgcggaactcgcggaggtggtggtgcccggggtgaccggcgacgtcgaa
aacaggacgcgcgcgctgatcgacaagctcgaagagatgattgcagccacgggcattccg
gcgcgcttgcgcgatgtgggcatcccgccggacggacttccgggaatggcgagcgacgcc
atgttgcagacacggctgctcgtgaacaacccgcggccagtcagtgagaacgatgcgctg
gcaatttatcaagccgcgttttga

DBGET integrated database retrieval system