KEGG   Burkholderia sp. CCGE1003: BC1003_5320Help
Entry
BC1003_5320       CDS       T01314                                 

Definition
Beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
bgf  Burkholderia sp. CCGE1003
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:bgf00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BC1003_5320
Enzymes [BR:bgf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     BC1003_5320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:2060618..2062615
Genome map
AA seq 665 aa AA seqDB search
MRLGVCYYPEHWPESMWEDDARRMKALGIEQVRIAEFAWSRIEPTPGEYDWAWLDRAVEV
LGAAGLQVVMCTPTATPPKWLIDRHPDILPIGADGRPRAFGSRRHYDFSSPSYFAASQKI
CTAIAERYGKHPAVAYWQTDNEFGCHHTVVSYSPAAVARFREWLRARYKTVDALNRAWGT
VFWSMEYRSFDEIDAPVATVTEAHPSHRLDYRRFASDEVARYNRMQVEIIRAHSPGRPVA
HNFMQLFTEFDHYKVAADLDVATWDSYPLGALEEQWFAPEVKARWLRSGHPDFASFNHDV
YRGMSKLPFWVMEQQPGPVNWAMWNPAPLPGMVRLWSWEAFAHGAGCVSYFRWRQAPFAQ
EQMHAGLNTPDNRLDVGGSEAEQVAKDIRTVLAANADANAAVRSKVALVYDYEAKWLFEI
HPQGADFHYPRFAFEYYSALRALGLDVDVVPVDASFDGYSMIVVPPLPMVPADFAARLAS
SGAQVVLGPRTGSKTQDLQIPANLPPGSLADVLPLRVWRVESMRPNVTEPVLSAGTQEPD
AAIGLARHWRDLIESRDAHAFDVLARFADGHPACVRSGAFHYFASLFDDSLTVRLFAQIA
QRAGIQTHPLGESVRVSRRGALTYVFNYGDTAHTLTDVAEDRFVIGSSTVPPQGVAVYRS
SGAVR
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atgcgccttggagtctgctattacccggaacactggccagagtcgatgtgggaagacgac
gcacgccgcatgaaagcactcggcatcgagcaggtgcgaattgccgagtttgcatggagc
cgtattgaaccgacgcctggcgaatacgattgggcgtggctcgatcgcgcggtagaagta
ctgggcgcagctggtttgcaggtggtcatgtgcacaccgacggcgacgccgccgaagtgg
ttgatcgaccgtcatccggacatcttgccgattggcgccgatggccgtccgcgcgcgttc
ggctcgcggcgtcactatgacttctcgtcgccttcgtattttgcggcctcgcaaaagatc
tgcacggcgattgccgagcgttacggcaagcatccggccgttgcgtactggcagaccgac
aacgagttcggttgccatcacaccgtggtgagttattcgccggccgcagttgcacggttt
cgggagtggctgagagcgcgctataaaacggtcgacgcgttgaatcgcgcgtggggcacg
gtcttctggagcatggagtaccgcagtttcgacgaaatcgacgcaccggtcgcaaccgtc
actgaagcgcatccgtcgcaccggctcgattatcggcgcttcgcgtccgacgaggtcgcg
cgttataaccgcatgcaggtcgagatcattcgcgctcattcgccggggcgtccggtcgcg
cacaacttcatgcagctgttcaccgagttcgatcactacaaggttgccgccgatctggat
gtcgccacctgggacagttatccgctaggcgcactcgaagagcaatggttcgcgcccgaa
gtaaaagcgcgctggttgcgcagcggtcatcctgacttcgcgtcgttcaatcatgacgtg
taccgcggcatgtcgaagctgccgttctgggtcatggaacagcaacccggtccggtgaac
tgggcgatgtggaatcccgcgccgcttcctggcatggtgcgtttgtggagttgggaagcg
ttcgcgcacggcgcgggctgcgtgtcgtatttccgctggcgtcaggcgccgtttgcccag
gagcagatgcacgctggcctgaatacgccggataaccggctcgacgtgggcggtagcgag
gcggagcaagttgccaaagacattcgcacagtacttgcagcgaacgccgacgccaatgcc
gcggttcggtcgaaagtcgcgctcgtgtacgactacgaagcgaagtggctgttcgaaatt
catccacaaggtgcggactttcactacccgcgcttcgcattcgagtactactccgcgttg
cgcgcgctaggtcttgatgtggatgtcgtgcccgtcgacgcatcgttcgacggctacagc
atgatcgtggtgccgccgctgccgatggtgcctgcggattttgccgcgcgtctggcaagc
tccggcgcgcaagtggtgctcgggccgcgcaccggttcgaagactcaggacttgcagatt
ccggcgaatcttccgcctggttcgctcgcagacgtgttgccgctgcgagtgtggcgtgtc
gaatcaatgcggcccaacgtgactgaacccgtgttgagtgcaggcacgcaagagcccgac
gcggcgattggccttgcgcgtcattggcgcgatttgattgaaagccgtgacgcgcatgca
ttcgacgtactcgcgcgttttgctgacggccaccctgcgtgcgtgcgaagcggcgcgttc
cattacttcgcgagcctgttcgacgactcgctcactgttcggctgttcgcgcagatcgca
cagcgcgcaggtattcagacgcatccgctcggtgagagcgtccgcgttagccggcgcggc
gcgctgacctacgtgttcaactacggcgatacagcgcacacgcttaccgatgtagccgaa
gacaggttcgtaatcggttcgagcacagtaccaccgcagggcgtagcggtttaccgatcc
agcggagcagttaggtaa

DBGET integrated database retrieval system