KEGG   Burkholderia sp. CCGE1003: BC1003_5676Help
Entry
BC1003_5676       CDS       T01314                                 

Definition
fumarate reductase/succinate dehydrogenase flavoprotein domain-containing protein
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
bgf  Burkholderia sp. CCGE1003
Class
Metabolism; Xenobiotics biodegradation and metabolism; Steroid degradation
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(2451970..2455380)
Genome map
AA seq 1136 aa AA seqDB search
MNRLSSAVTAMKSHYEVVVIGSGYGGAIAASRMARAGRSVCVLERGREFMAGEYPRTPFQ
GAAQIQYNTPAAQIGSPLALLEVHVNDDVNAVVGCGLGGTSLINANVALKVDPRLWDDTR
WPAALREDQAGRDTGYQRAWDMLQPSPVPGRFRELPKLLALAKSAEALGMADHFSTPPVT
VTFEDRTNAAGVAQKACTGCGDCNSGCNYDAKNSTHMNYLPDAVAHGAQIFTGAAVHSVT
RNTDTQKWQVGYQLVRLGRESYDAPDLFVSADVVIVSAGTIGSTALLLRSRNEGLSVSGM
LGQRFTGNGDVLAFAYNTDDTINGVGWGAHLEGELPPVGPTITGLIDHRDTPDVKDGFVI
EEGSLAGPVGAALVGMLGAAAPLSGVDVAGPRPVEQQLAYDARVVEAVLHGPYRGALNHT
QSYLVMAHDDESGQISVNDKGRPRITWENAGKQPIYETVEETLKNATAPLGGKYLRDPIS
NDIFGNRTVTVHPLGGCAMGEHAEQGVVDHMGRVFSGMTGTDVHDGLYVMDGAVMPMSLG
VNPLWTISALAERNCALLAASRGWTIDYDSRGTAAAPPAQKIGLRFTETMVGHYTPAGAS
DDAASPMAFTLTVESDDLDAMLRDPNHMARTAGTLSCIALSAQPMTITDGTFNLFVTDPQ
DVDERNMNYRMTLNAVEGKTYYLSGQKIITRTSPLELWEQTNTLYAQVFEAPEADAPPLG
NAKLIITPENFLKQQRTLEVTNAPDLKTRLEWTLKFGKFFAGVLFSEYGGVAAPLQYHDP
DAPPRLKRALRAPAPQVFFFDTPDGTRLRLTRFVDPARKNARPVLLIHGSGVSSRIYSTD
LIGTNLVEYLCAAGYDVWLVDLRVSIEMPSVLVPTNVDKVALEDIPAAVAKIREVTGAPA
IQALGHCMGGLALSMSLMAGLQGVRSAVISQVAAHPVPGALGRIKAGLHIPDIMQHLGVT
DLTAYTRDERWPHNLFDEALRLYPVDHDEGCGNPICHRATFMYGLLYEHAQVNETLHSNL
QELLGVHDVGVFRHLAAMVRAGKVVDAEGNDVYLRGARGMKGLTGMRIPIGFIHGECNAT
YVPKSTALTYEMLADAFPEQPYERYLIPGYGHIDCIFGKNAALDVYPTIASYLNAH
NT seq 3411 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgcttatcgagcgccgtgacggcgatgaaatcgcactatgaagtggtggtgatc
ggttccggttacggcggcgcgatcgccgcgagccgcatggcgcgcgcggggcgcagcgtc
tgcgtgctcgaacgcgggcgcgaattcatggccggcgaatatccgcgcacaccgtttcag
ggcgccgcgcagatccagtacaacacgccagccgcgcaaatcggctcgccactcgcgctg
ctcgaagtacatgtgaacgacgacgtgaacgcagtggtgggctgcggccttggcggcact
tcgctgatcaacgcgaacgtcgcgctcaaagtcgatccgcgcctgtgggacgacacgcgc
tggcccgccgcgctgcgcgaagaccaggctgggcgcgacacaggttatcagcgcgcatgg
gacatgttgcaaccctcgccggttccgggccgttttcgcgaactgccgaaactgctggca
cttgcaaagtccgccgaggcactcggcatggccgaccacttcagcacgccgcccgtgacc
gtgactttcgaggaccgcacgaacgcggccggcgtcgcccagaaagcctgcaccggatgc
ggcgactgcaactcaggttgcaactacgacgcgaaaaattcgacgcatatgaactatctg
cccgacgcagtcgcgcacggcgcgcagattttcaccggcgccgccgtccattcggtgacc
cgcaataccgatacgcagaaatggcaagtgggctatcaactcgtgcgcctcgggcgtgag
agctacgacgcgcctgaccttttcgtgagtgcggatgttgtcatcgtgtcggcgggaaca
atcggctcgaccgcgttgctgctgcgttcgcgcaatgaggggctgagcgtctcgggcatg
ctcggccagcgcttcaccggcaatggcgacgtgctggccttcgcctacaacaccgacgac
accatcaacggcgtcggctggggcgcgcatctggaaggcgagcttccgcccgtagggccg
accattacggggctgatcgatcatcgcgatacgcctgacgtcaaagacggcttcgtgatc
gaagaaggctcgctcgcggggccagtgggcgccgcgctcgtcggcatgctcggcgccgct
gcgccgctttcgggcgtcgacgtcgcgggcccgcgcccggtcgagcagcaactcgcttac
gatgcacgcgttgtcgaagccgtcctgcacggaccgtatcgcggcgcgctcaatcacacg
cagagctacctcgtgatggcgcacgacgacgaaagcggccagatcagcgtcaacgacaag
ggccgcccgcgcattacatgggaaaacgccggtaaacagcccatttacgaaaccgtcgaa
gagacgctgaagaatgcgacggccccgctaggcggcaagtacctgcgcgacccgatttcc
aacgacatcttcggcaaccgcaccgtgaccgtgcatccgctcggcggctgcgcaatgggc
gagcacgccgaacagggtgtggtcgaccatatgggccgcgtgttcagcggcatgaccggc
acggatgtgcacgacggcctctacgtcatggacggcgcggtcatgccgatgtctctcggc
gtgaatccgctgtggaccatctctgcgctcgccgagcgcaactgcgcgctgctcgcggcg
tcgcgaggctggaccatcgactacgattccaggggcaccgccgccgcgccgcccgcgcaa
aaaatcggcctgcgcttcaccgaaacaatggtcggccattacacgccggccggcgcgagc
gacgacgcagcaagcccgatggccttcacgctgactgtggagtccgacgacctcgacgca
atgcttcgggatcccaatcatatggcccggaccgccggcacgttgagctgcattgcactg
tccgcgcagccgatgacgattacggacggcaccttcaatctgttcgtgaccgacccgcaa
gatgtcgacgagcgcaacatgaactaccgcatgacgctcaatgccgtggaaggcaagacc
tactatctgagcgggcaaaaaatcatcacgcgcacgtcgccgctcgagttgtgggagcag
accaatacgctctatgcgcaggtgttcgaagcgccggaagccgacgcgccgccgcttggc
aacgccaagctgatcatcacgccggaaaatttcctgaaacagcagcgcacgctcgaagtg
accaacgctccggatctgaaaacccgcctcgaatggacgctcaagttcggcaagttcttt
gctggcgtactgttcagcgaatacggcggcgtcgccgcgcctttgcagtaccacgacccc
gacgcgccgccgcgtctgaagcgcgcactgcgggcgccggcgccgcaagtgttcttcttc
gacacgcctgacggcacgcgtctgcggctcacgcgctttgtcgatccggcgcgcaagaac
gcgcgccccgtgttgctgattcacggctccggcgtgtcgagtcgcatctactcgacggat
ctgatcggcaccaatctggtcgaatatctgtgcgccgcgggttacgacgtatggctcgtc
gacctgcgcgtgagcatagaaatgccgagcgtgctcgtgccgaccaacgtcgacaaggtc
gcactggaggacattcccgcagccgtcgcgaagattcgcgaggtgaccggcgcgcccgcc
atccaggcgctcggccactgcatgggcggcctcgcgttgagcatgtcgctgatggcggga
ctgcaaggcgtgcgctccgcggtgatttcccaggtcgccgcgcatccggtgccgggcgcg
cttggccgcatcaaggcggggctgcacattcccgacatcatgcaacacctgggcgtgacc
gatctcaccgcctatacccgggacgaacgctggccacacaatctgttcgacgaagcgctg
cgcctgtaccccgtcgatcacgacgaaggctgcggcaatcccatctgccatcgcgccaca
ttcatgtacgggctgctctacgaacacgcgcaggtcaacgagacgcttcattccaacttg
caggaattgcttggcgtgcacgacgtcggcgtgttcaggcatctggcggccatggtgcgc
gcgggcaaagtcgtcgacgcggaaggaaacgatgtctatctgcgtggagcgcgcggcatg
aagggcctgacaggcatgcgtattccgattggcttcatccacggcgagtgcaacgcaacg
tatgtaccgaagagcaccgcgttaacctatgagatgcttgccgacgcctttcccgagcaa
ccttacgagcgctacctgattccgggctatggacacatcgactgcattttcggcaagaac
gctgcgctcgacgtgtatccgactatcgcgagctatctgaacgcgcactga

DBGET integrated database retrieval system