KEGG   Burkholderia sp. CCGE1003: BC1003_5845Help
Entry
BC1003_5845       CDS       T01314                                 

Definition
Magnesium chelatase (EC:6.6.1.1)
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
bgf  Burkholderia sp. CCGE1003
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:bgf00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:2657028..2658197
Genome map
AA seq 389 aa AA seqDB search
MNAGTNAGTNAGTNAGTNVGTNVGTNAGTSDARTGDARTGAVPRPAFPFAALIGQAALQQ
ALLLAAIDPGIGGVLVSGPRGTAKSTAARALAELLPEGQLVNLPLGASEDRLIGTLDIET
VLRDGSVRFSPGLLAKAHRGVLYVDEVNLLPDTLVDALLDAAASGVNTVERDGVSHSHEA
SFVLIGTMNPEEGELRPQLIDRFGLVVQLHNCYEPGVREQIVKARLAFDLDPAGFRAGYA
TQQAQYVQRIRAARETLPRLSFDDAVHAQVSRLCIDAAVDGLRADLVMLRAARALAAWEL
ADGITTQHVDRVAEAVLVHRRREQRGSSTSGTNAPDTPPLSQSDDVPPDSAGPSQESASG
GEGDWGYLPPQPAAIRHVKGVIPLDVKKR
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcaggcaccaatgcaggcaccaatgcaggcaccaatgcaggcacgaatgtgggc
acgaatgtgggcacgaatgctggcacaagcgatgcgcgcacaggcgatgcgcgcacaggc
gcggtgcccagacccgcgtttccgtttgccgcgctgatcggtcaagccgcattgcagcag
gcactgctgctcgcggcgatcgatccgggaattggcggtgtgctggtgagcgggccgcgc
ggcacggcgaaatccaccgcggcgcgcgcgctcgctgagttgttgccggaaggacaactc
gtgaacctgccgcttggcgcaagcgaagaccggctgatcggcacgctcgacattgaaacc
gtgttgcgcgacggctcggtgcgcttctcgcctgggttgctcgcgaaagcgcatcgcggc
gtgctgtacgtggacgaagtcaacctgctgcccgatacgctcgtcgacgccttgctggat
gcggccgccagtggcgtgaatactgtcgaacgcgatggcgtatcgcacagtcacgaggcg
agcttcgtgctgatcggcacgatgaatccggaagagggcgaactgcggccgcaactgatc
gaccgcttcggcctggtggtgcagttgcacaactgctatgagccgggcgtgcgcgagcag
atcgtgaaagcgcgtcttgcgttcgatctcgatcccgccggttttcgcgccggttatgca
acgcagcaggcgcagtatgtgcagcggattcgcgcggcacgcgagacactgccgcgactt
tctttcgacgatgcagtgcatgcgcaagtgagccggttgtgtatcgacgctgccgtcgac
ggcttgcgtgcggacctggtgatgctgcgcgccgcgcgagcgctcgctgcatgggagctg
gcggacgggatcaccacacaacatgtcgatcgagtggcagaggcagtgctcgtgcataga
cgccgtgagcagcgtggatcgtcgacaagcggcacaaacgcgccggatacgccgccgctt
tcacagtcggatgatgtgccgccggattcggccgggccatcgcaggagagcgcaagcggc
ggcgaaggcgattggggttacttgcctccgcaaccagctgcgatccgacacgtcaaaggc
gtgattccgctcgatgtaaaaaaacgctga

DBGET integrated database retrieval system