KEGG   Burkholderia sp. CCGE1003: BC1003_5853Help
Entry
BC1003_5853       CDS       T01314                                 

Definition
Di-heme cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
bgf  Burkholderia sp. CCGE1003
Brite
Enzymes [BR:bgf01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     BC1003_5853
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(2673179..2674630)
Genome map
AA seq 483 aa AA seqDB search
MNQTPDAALPPTLPAGGEPGPVRVQRSLRGVVAWAAACVVSAAVAFGAYALIYPERMPVA
LGALVEEITGANPQPVHLLRPARAPLSAVALLGKEIFFDQSLSASGTQSCASCHSPNNSY
SPDNAFPVQLGGAHMNEAGYRPPPSLTYLYRQAPFSIGPDQGDTDAPVDLTQLASQAAGT
QRAQKTALAAPAAPALVPQGGLFWDGRADTLQDQAIGPLTNPVEMANKTPEDVAQKLLHT
RYIGQFKQIFGPAIEANPSLLVSEAMFAVGRYQIEDPSFHAFTSKYDYWLEGKARLTRAE
LHGLQLFNDKDKANCAGCHLSQPGKDGLPPVFTDTQYEALGVPRNPAIPANRDPGFFDMG
VCGPFRHDLAKETQYCGMFLTPTLRNVANRKAFFHNGVYHDLKQVMDFYNLRNTSPEKIY
PRDASGKVQKYNDLPAQYHANVDASDAPFDRKLGDKPAMSDADIEDIIAFMKTLSDGYHV
GGS
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagactccagacgctgccctgccgccgacacttcccgccggcggcgaaccgggc
cctgtccgcgtgcaacgctcgttacgcggcgtcgttgcgtgggccgctgcgtgcgtcgtc
agcgcggccgttgcgttcggtgcgtatgcactgatttaccccgagcgcatgccggttgcg
ctcggcgcgctggtcgaagagataaccggcgcgaacccgcagccggtgcatttgctgcgt
cctgcgcgtgcaccgttgagtgcggttgcactgcttggcaaggagatatttttcgaccag
tctttatccgcttccggcacgcagtcgtgcgcgtcttgccactcgccgaacaactcgtat
tcgccggataatgcgtttccggttcaactcggcggcgcgcacatgaacgaagccggttat
cggccgccgccgtcgctcacttacttgtatcgtcaggcgccgttcagcattggtccggac
cagggcgacaccgacgcgccggtggacctgacgcaactggcctcacaagccgccggcacg
cagcgcgcgcaaaagactgcactcgccgcgcctgccgctccggcgctggtgccgcaaggc
ggtctcttctgggacggacgcgccgatactttgcaggaccaggcaatcggaccgctgacc
aatccggtggaaatggcgaacaagacgccggaagacgttgcgcagaagcttttgcacacc
cgctacatcggccagttcaagcagattttcggcccggccatcgaggcgaaccccagtctg
ctggtgtccgaggcgatgttcgccgtggggcgttatcagattgaagacccgtcgtttcac
gcctttaccagcaagtacgactactggctggaaggcaaggctcgcctcacgcgcgccgaa
ctgcacggcctgcaactgttcaacgacaaggacaaggccaactgtgcaggctgtcacctg
agtcagcctggcaaagacggcctgccgccggtgttcaccgatacccaatacgaggcgctc
ggcgtgccgcgcaatccggccattcctgcgaacagggaccccggcttcttcgatatgggg
gtatgtgggccgtttcgtcatgacctcgcaaaagagacgcagtattgcggcatgtttctc
acgccgacgctgcgcaatgtcgcgaaccgcaaggcgtttttccacaacggcgtgtatcac
gacctgaagcaggtgatggacttctacaacctgcgcaatacgtcgccggaaaaaatctat
ccgcgcgacgcgtcgggcaaggtgcagaagtacaacgatttgcccgcgcagtatcacgcg
aacgtggatgcttcggacgcgccttttgaccgcaaattgggcgataagccagcaatgagc
gacgcggatatcgaggacatcatcgcgttcatgaagacgttgagtgacgggtatcacgtc
gggggatcctga

DBGET integrated database retrieval system