KEGG   Burkholderia sp. CCGE1003: BC1003_5874Help
Entry
BC1003_5874       CDS       T01314                                 

Definition
(GenBank) formaldehyde dehydrogenase, glutathione-independent
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
bgf  Burkholderia sp. CCGE1003
Pathway
bgf00625  Chloroalkane and chloroalkene degradation
bgf00680  Methane metabolism
bgf01100  Metabolic pathways
bgf01120  Microbial metabolism in diverse environments
bgf01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bgf00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    BC1003_5874
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BC1003_5874
Enzymes [BR:bgf01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     BC1003_5874
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C PALP FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ADN61785
JGI: BC1003_5874
UniProt: E1THC8
Position
2:2699746..2700945
Genome map
AA seq 399 aa AA seqDB search
MSSNRGVVYLGQGKVEVQSIDYPKMVDPRGRAIGHGVILKVVSTNICGSDQHMVRGRTTA
EVGLVLGHEITGEVIEVGRDVETLAIGDLVSVPFNVACGRCPTCKSQHTGVCLNVNPSRA
GGAYGYVDMGGWIGGQAEYVMVPYADFNLLKFPDRAQAMAKIRDLTCLSDILPTGYHGAV
MAGVKPGATVYIAGAGPVGMAAAASARLLGAACTIVGDMNEARLAHARKMGFETVDLSKD
ATLGEQIEQILGKPEVDCAVDCVGFEAHGHGSSGSHEEAPATVLNSLMEITRAAGAIGIP
GLYVTDDPGAVDAAARKGSLSIRFGLGWAKSHSFHTGQTPVMKYNHNLMQAILWDRLPIA
DIVNVTVVSLDQAPDGYRQFDGGAPRKFVIDPHGLLKAA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaatcgcggcgtcgtctatctggggcagggcaaggttgaagtgcaatccatc
gactatccgaagatggtcgacccacgtggccgtgcaatcggtcacggtgtgattctgaag
gtagtcagcacgaatatttgcggctcggaccagcacatggtgcgcggtcgcaccactgcc
gaggtcggcctcgtgctcggccacgaaattaccggcgaagtaatcgaagtaggccgcgac
gtggaaacgctcgccatcggcgatctcgtctcggtgccgttcaatgtggcttgcggccgg
tgcccgacctgcaagtcgcagcatacgggcgtgtgcctgaacgtgaatccttcgcgcgcg
ggcggcgcatacggatatgttgacatgggcggctggatcggcggccaggctgagtacgtg
atggtgccgtacgccgatttcaatctgctgaagtttcccgaccgcgcgcaggccatggcg
aagatccgcgacctgacatgcctgtccgatattctgcccaccggctatcacggcgcggtc
atggcaggggtgaagccgggcgcgacggtctacatcgcaggtgcgggaccggtcggcatg
gcggcggccgcgtcggcgcgcctgttgggcgcggcatgtacgattgtcggcgacatgaac
gaggcgcgcctcgcgcatgcccgcaagatgggtttcgaaacggtggacttgtcgaaagac
gcgacgctcggcgaacagatcgagcagattctcggcaaaccggaagtggattgcgcggtg
gattgcgtgggcttcgaggcgcacggccacggcagcagcggttcgcatgaagaggcgccg
gccaccgtgctcaactcgctgatggaaatcacgcgggccgcgggcgcgatcggcattccg
ggcctctacgtgaccgacgatccgggcgccgttgacgccgccgcgcgcaaaggcagcctg
agcatccgcttcggccttggttgggcgaagtcgcattcattccacaccggccaaacgccg
gtaatgaagtacaaccacaacctgatgcaggcgatcttgtgggaccgcctgccgattgca
gacatcgtgaacgtgacggtggtgtcgctcgatcaggcgccggacggctatcgacagttc
gacggcggcgcgccgcgcaagttcgtgatcgatccgcacgggctgctgaaggcggcgtga

DBGET integrated database retrieval system