KEGG   Burkholderia sp. CCGE1003: BC1003_5874Help
Entry
BC1003_5874       CDS       T01314                                 

Definition
formaldehyde dehydrogenase, glutathione-independent
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
bgf  Burkholderia sp. CCGE1003
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bgf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BC1003_5874
  Energy metabolism
   00680 Methane metabolism
    BC1003_5874
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BC1003_5874
Enzymes [BR:bgf01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     BC1003_5874
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:2699746..2700945
Genome map
AA seq 399 aa AA seqDB search
MSSNRGVVYLGQGKVEVQSIDYPKMVDPRGRAIGHGVILKVVSTNICGSDQHMVRGRTTA
EVGLVLGHEITGEVIEVGRDVETLAIGDLVSVPFNVACGRCPTCKSQHTGVCLNVNPSRA
GGAYGYVDMGGWIGGQAEYVMVPYADFNLLKFPDRAQAMAKIRDLTCLSDILPTGYHGAV
MAGVKPGATVYIAGAGPVGMAAAASARLLGAACTIVGDMNEARLAHARKMGFETVDLSKD
ATLGEQIEQILGKPEVDCAVDCVGFEAHGHGSSGSHEEAPATVLNSLMEITRAAGAIGIP
GLYVTDDPGAVDAAARKGSLSIRFGLGWAKSHSFHTGQTPVMKYNHNLMQAILWDRLPIA
DIVNVTVVSLDQAPDGYRQFDGGAPRKFVIDPHGLLKAA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaatcgcggcgtcgtctatctggggcagggcaaggttgaagtgcaatccatc
gactatccgaagatggtcgacccacgtggccgtgcaatcggtcacggtgtgattctgaag
gtagtcagcacgaatatttgcggctcggaccagcacatggtgcgcggtcgcaccactgcc
gaggtcggcctcgtgctcggccacgaaattaccggcgaagtaatcgaagtaggccgcgac
gtggaaacgctcgccatcggcgatctcgtctcggtgccgttcaatgtggcttgcggccgg
tgcccgacctgcaagtcgcagcatacgggcgtgtgcctgaacgtgaatccttcgcgcgcg
ggcggcgcatacggatatgttgacatgggcggctggatcggcggccaggctgagtacgtg
atggtgccgtacgccgatttcaatctgctgaagtttcccgaccgcgcgcaggccatggcg
aagatccgcgacctgacatgcctgtccgatattctgcccaccggctatcacggcgcggtc
atggcaggggtgaagccgggcgcgacggtctacatcgcaggtgcgggaccggtcggcatg
gcggcggccgcgtcggcgcgcctgttgggcgcggcatgtacgattgtcggcgacatgaac
gaggcgcgcctcgcgcatgcccgcaagatgggtttcgaaacggtggacttgtcgaaagac
gcgacgctcggcgaacagatcgagcagattctcggcaaaccggaagtggattgcgcggtg
gattgcgtgggcttcgaggcgcacggccacggcagcagcggttcgcatgaagaggcgccg
gccaccgtgctcaactcgctgatggaaatcacgcgggccgcgggcgcgatcggcattccg
ggcctctacgtgaccgacgatccgggcgccgttgacgccgccgcgcgcaaaggcagcctg
agcatccgcttcggccttggttgggcgaagtcgcattcattccacaccggccaaacgccg
gtaatgaagtacaaccacaacctgatgcaggcgatcttgtgggaccgcctgccgattgca
gacatcgtgaacgtgacggtggtgtcgctcgatcaggcgccggacggctatcgacagttc
gacggcggcgcgccgcgcaagttcgtgatcgatccgcacgggctgctgaaggcggcgtga

DBGET integrated database retrieval system