KEGG   Burkholderia glumae BGR1: bglu_1g00860Help
Entry
bglu_1g00860      CDS       T00905                                 

Definition
(GenBank) putative periplasmic substrate-binding protein
  KO
K01999  
branched-chain amino acid transport system substrate-binding protein
Organism
bgl  Burkholderia glumae BGR1
Pathway
ABC transporters
Quorum sensing
Module
Branched-chain amino acid transport system
Brite
KEGG Orthology (KO) [BR:bgl00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    bglu_1g00860
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    bglu_1g00860
Transporters [BR:bgl02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Branched-chain amino acid transporter [MD:M00237] [OT]
    bglu_1g00860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:91394..92533
Genome map
AA seq 379 aa AA seqDB search
MQHTMKKVAGATLVAVMSLAGAAHAEDVKIGFAAPMTGAQAHYGKDMQNGIVLAIEDFNA
TKPVIGGKPVTFVLDTQDDQADPRTGTTVAQKLVDDGIKGMLGHFNSGTTIPASRIYANA
GIPEIAMATAPEYTQQGYKTTFRMMTSDTQQGSVAGMFAVKDLGKKRIAIVDDRTAYGQG
LADQFEKAAKAAGATIVDREFTNDKAVDFKAILTKLKAAKPDLIYYGGADSQGAPMVKQM
KSLGITAPLMSGEMVHTPTFLKIAGEAADGTIASLAGLPLSDMPGGKAYAEKYKKRFGED
VQTYSPYAYDGAIAMFTAMKKADSTDPAKYLPVLAKTDMAGVTSTHIAYDSKGDLRNGGI
TMYKVVKGEWVPLKSIGGK
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgcaacacacgatgaaaaaagtggcaggcgcgacgttggttgcggtcatgtcgctggcg
ggggcagcccacgcggaagacgtgaagatcggcttcgcggcgccgatgacgggagcgcag
gcgcactacggcaaggacatgcagaacggcatcgtgctggcgatcgaagacttcaacgcg
acgaagcccgtgatcggcggcaagccggtgacgttcgtgctcgacacgcaggacgaccag
gccgatccgcgcacgggcaccacggtcgcgcagaagctcgtcgacgacggtatcaagggc
atgctgggccacttcaactccggcaccacgatcccggcctcgcgcatctacgcgaacgcc
ggcatcccggaaatcgccatggcgacggcgccggagtacacgcagcagggctacaagacc
accttccggatgatgacgtccgacacgcagcagggctcggtggcgggcatgttcgcggtg
aaggacctgggcaagaagcggatcgccatcgtggacgaccgcaccgcctacggccagggt
ctcgccgatcagttcgagaaagccgccaaggcggccggcgcgaccatcgtcgatcgcgag
ttcacgaacgacaaggccgtcgatttcaaggcgatcctgaccaagctgaaggccgccaag
ccggacctgatctattacggcggcgccgattcgcagggcgcgccgatggtcaagcagatg
aagtcgctcggcatcacggcgccgctgatgagcggcgagatggtgcacacgccgaccttc
ctgaagattgccggcgaagccgcggacggcacgatcgcgtcgctcgcgggcctgccgctg
agcgacatgccgggcggcaaggcctacgccgagaagtacaagaagcgcttcggcgaggac
gtgcagacctactcgccgtatgcctacgacggcgcgatcgcgatgtttaccgcgatgaag
aaggccgactccaccgacccggccaagtatctgccggtgctggcgaagaccgacatggcg
ggcgtgacctcgacgcacatcgcctacgactcgaagggtgacctgcgcaacggcggcatc
acgatgtacaaggtcgtgaagggcgagtgggtgccgctcaagagcatcggcggcaagtaa

DBGET integrated database retrieval system