KEGG   Burkholderia glumae BGR1: bglu_1g00900Help
Entry
bglu_1g00900      CDS       T00905                                 

Definition
(GenBank) MerR family regulatory protein
Organism
bgl  Burkholderia glumae BGR1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MerR_1 MerR-DNA-bind MerR Pkip-1 Fzo_mitofusin NYD-SP28_assoc
Motif
Other DBs
NCBI-ProteinID: ACR27293
UniProt: C5A884
Position
1:complement(95780..96211)
Genome map
AA seq 143 aa AA seqDB search
MKIGELAKAARCTPETVRFYEKEGLMPDAERTDANYRRYTEVHVERLRFIRNCRALDMTH
DEIRALLRLTDDPSDRCDSINALLDEHIGHVNARLVELQHLKAQLSDLRDRCQGEHTVED
CGIVHGLATMETPEAPAKRTHLG
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcggcgaactcgcgaaagccgcccgctgcacgcccgagaccgtccgtttctac
gagaaggagggcctgatgccggatgcggagcgcaccgacgcgaactaccggcgctacacc
gaggtccacgtcgagcgcctgcgcttcatccgcaactgccgcgcgctcgacatgacgcac
gacgagatccgcgcgctgctgcgcctcaccgacgacccgtccgaccgctgcgattcgatc
aacgcgctgctcgacgagcacatcggccatgtgaacgcacggctcgtcgaactgcagcac
ctgaaggcgcagctctcggacctgcgcgaccggtgccagggcgagcacacggtagaggac
tgcgggatcgtgcacggcctggccacgatggaaacgcccgaggcgccggccaagcgcacc
cacctcggctga

DBGET integrated database retrieval system