KEGG   Burkholderia glumae BGR1: bglu_1g00910Help
Entry
bglu_1g00910      CDS       T00905                                 

Definition
(GenBank) Heavy metal translocating P-type ATPase
  KO
K01534  
Cd2+/Zn2+-exporting ATPase [EC:3.6.3.3 3.6.3.5]
Organism
bgl  Burkholderia glumae BGR1
Brite
Enzymes [BR:bgl01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.3  Cd2+-exporting ATPase
     bglu_1g00910
    3.6.3.5  Zn2+-exporting ATPase
     bglu_1g00910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:96294..98735
Genome map
AA seq 813 aa AA seqDB search
MAQVNELPDAADADMAGPRAATACCGAARTSGAPRAGACAHDDHGHAAGHAHGHAPGHGH
SHEHASDHGHSHDHSSNRAHSHDHDHGADCCAPAARALTPLPDTSRLADGSERTAFRIMQ
MDCPTEETLIRKKLGGMAAVTALDFNLMQRMLTVVHAPGAAGAVAAAIRSLGMTPEAAGA
GASAAGAVRAAEAKPLWPLVTAGAAALASEALTWAGLPSWLAALLAVAAVALCGSSTYRK
GWIAIRNGNLNINALMSIAVTGAMLIGQWPEAAMVMVLFTIAELIEAKSLDRARNAIQGL
MRLAPDTATVRRPDGSWASMAAAEVALGAIVRVRPGERVGLDGELVAGRSTVNQAPITGE
SLPVEKAPGDAVFAGTINEAGSFEYRVTAVASNTTLARIIHAVEAAQGAKAPTQRFVDRF
ARVYTPIVFAIALVVALAPPLLAGGAWHDWCYRALVLLVIACPCALVISTPVTIVSGLAS
AARCGILVKGGVYLEEGRKLGWLALDKTGTLTHGKPVRTDVEPFARDVEPARVAWLAASL
ASRSDHPVSQALATAAAAEGVRAFAEVDGFEALPGRGVRGEIEGVAHWLGNRRLAAELGR
ASAALDARVAELEAQGKTVVMLGDAVRVLGLFAVADTVRDTSREAVAQLHALGIRTAMLT
GDNAHTAAAIAREVGIDDARGGQLPEDKLAAVAELARQGRAVGMVGDGINDAPALARADI
GFAMGAMGTDTAIETADVALMDDDLRKIPAFVRLSRATHRVLLQNIGFALVVKLVFLGLT
LAGLGTMWMAVFADAGASLIVVANGLRLLRASR
NT seq 2442 nt NT seq  +upstreamnt  +downstreamnt
atggcccaggtgaacgaactgcccgacgcggctgacgccgacatggccgggccgcgcgcg
gcaacggcctgctgcggcgccgcgcggacaagcggggcgccgcgggcgggcgcgtgcgcg
cacgatgatcacggccatgccgccggccatgcgcacgggcacgcaccgggccacggccat
tcgcacgagcacgcgtcggaccacggtcactcgcacgaccactcgtcgaatcgcgcgcat
tcgcacgaccacgaccacggcgccgactgctgcgcgcccgcggcgcgcgcgctcacgccg
ctgccggacaccagccggctcgccgacggcagcgagcgcaccgcgtttcgcatcatgcag
atggactgcccgaccgaggagacgctgatccgcaagaagctcggcgggatggccgcggtc
accgccctcgatttcaacctgatgcagcggatgctgacggtggtgcatgcgccgggcgca
gccggcgcggtggccgccgcgatccgctcgctcggcatgacgccggaggcggccggcgcc
ggtgcgtccgccgccggcgcggtgcgcgcggccgaggcgaagccgctctggccgctcgtc
acggccggcgcggcggcgctcgcctccgaggcgctgacctgggccggcctgccgagctgg
ctggcggcgctgctcgcggtggccgccgtcgcgctctgcggctcgagcacctatcgcaag
ggctggatcgcgatccgcaacggcaacctgaacatcaacgccctgatgagcatcgccgtg
acgggcgcgatgctgatcggccagtggcccgaggccgcgatggtgatggtgctgttcacg
atcgccgagctgatcgaggcgaagtcgctcgaccgtgcgcgcaatgcgatccagggcctg
atgcggctcgcgcccgacacggccacggtgcgccggcccgacggcagctgggcctcgatg
gcggccgccgaggtcgcgctcggcgcgatcgtgcgcgtgcggccgggcgagcgcgtcgga
ctcgacggcgagctcgtggccggccgctccacggtgaaccaggcgccgatcacgggcgag
agcctgccggtcgagaaggcgcccggcgacgccgtgttcgccggcaccatcaacgaggcc
ggctcgttcgagtaccgcgtcacggcggtggcctcgaacaccacgctcgcgcgcatcatc
cacgcggtcgaggcggcgcagggcgcgaaggcgcccacccagcgcttcgtggaccgcttc
gcgcgcgtctacacgccgatcgtgttcgcgatcgcgctggtggtggcgctcgcgccgccg
ctgctggcgggcggcgcctggcacgactggtgttatcgcgcgctggtgctgctggtgatc
gcctgcccctgcgcgctggtgatttccacgccggtgacgatcgtctcggggctggcgtcc
gcggcgcggtgcggaattctcgtgaagggcggtgtctatctcgaggaaggccgcaagctc
ggctggctcgccctcgacaagaccggcacgctcacgcacggcaagccggtgcgcaccgat
gtcgagccgttcgcgcgcgacgtcgagccggcgcgcgtcgcatggctcgccgccagcctc
gcgagccgctccgatcacccggtctcgcaggcgctcgcaaccgcggcggcggccgagggc
gtgcgggcattcgccgaagtggacggcttcgaggcgctgcccgggcgcggcgtgcgcggc
gagatcgagggcgtcgcccactggctcggcaatcgccggctcgcggccgagctcggccgc
gcctcggcggcgctcgacgcgcgcgtggccgagctcgaggcgcagggcaagaccgtggtg
atgctcggcgacgcggtgcgcgtgctcggcctgttcgcggtggccgacacggtccgcgac
acgagccgcgaggcggtggcgcagctgcacgcgctcggcatccgcacggcgatgctgacg
ggcgacaacgcgcataccgccgcggcgatcgcgcgcgaggtcggcatcgacgacgcgcgc
ggcggccagctccccgaggacaagctcgccgcggtcgccgagctggcccggcagggccgc
gcggtggggatggtcggcgacggcatcaacgacgcgcccgcgctcgcgcgcgccgacatc
ggcttcgcgatgggcgcgatgggcaccgacaccgcgatcgagacggccgacgtcgcgctg
atggatgacgacctgcgcaagatccccgcgttcgtgcggctttcgcgcgccacccatcgc
gtgctgctgcagaacatcggtttcgcgctggtggtgaagctggtgttcctcgggctcacc
ctggccggcctcggcacgatgtggatggccgtgttcgccgatgcgggcgcgagcctgatc
gtcgtcgccaacggcctgcggctgctgcgcgcctcgcgctga

DBGET integrated database retrieval system