KEGG   Burkholderia glumae BGR1: bglu_1g00920Help
Entry
bglu_1g00920      CDS       T00905                                 

Definition
(GenBank) Ethanolamine transproter
  KO
K16238  
ethanolamine permease
Organism
bgl  Burkholderia glumae BGR1
Brite
Transporters [BR:bgl02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   bglu_1g00920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:99244..100650
Genome map
AA seq 468 aa AA seqDB search
MHAESNGRPAAGGAPGPALKQTLGTWQLWGIAVGLVISGEYFGWSYGWASAGTLGFVVTA
LFIAAMYTTFIFSFTELTTSIPHAGGPFAYARRAFGPAGGYLAGVATLVEFVFAPPAIAL
AIGAYLHVQFPSLEPKHAAMGAYLVFMALNIVGVQIAATFELIVTLLAIFELLVFMGVVS
PGFSWDHFAKGGWGGADHFSPGALHGMFAAIPFAIWFFLAIEGVAMAAEEAKHPRRSIPI
AYVAGILTLVVLAVGVMVFAGGAGDWTKLANINDPLPQAMKYIVGEHSGWMHMLVWLGLF
GLVASFHGIILGYSRQIFALAREGYLPEWLAKVHPRFRTPYRAILAGGVVGIAAIYSDEL
IQFGGQTLTANIVTMSVFGAIVMYIVSMAALFKLRRSQPAMARPFRAPLYPLFPAFALAA
ALVCLATMVYFNALVALVFLVFVALGYGYFIATRSQRAAAPAEALLKE
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgcacgcagagtcgaacggccgtcccgcagcgggcggcgcgccggggccggcgctgaaa
cagaccctcggcacctggcagctgtgggggatcgcggtcggcctggtgatctcgggcgaa
tatttcggctggagctacggctgggccagcgccggcacgctcggcttcgtggtcacggcg
ctgttcatcgcggcgatgtacaccaccttcatcttcagcttcaccgagctgaccacctcg
atcccgcacgcgggcggcccgttcgcctacgcgcgccgcgcgttcggcccggcgggcggc
tatctggccggcgtcgccacgctggtggagttcgtgttcgcaccgcccgcgatcgcgctc
gcgatcggtgcctacctgcacgtgcagttcccgtcgctggagcccaagcacgcggcgatg
ggcgcctatctcgtgttcatggcgctcaacatcgtcggtgtgcagatcgccgccaccttc
gagctgatcgtcacgctgctggcgatcttcgagctgctggtgttcatgggcgtggtgtcg
ccgggcttctcgtgggaccacttcgccaagggcggctggggcggtgccgatcatttctcg
cccggcgcgctccacggcatgttcgcggcgatcccgttcgcgatctggttcttcctcgcg
atcgagggcgtggcgatggccgccgaggaggcgaagcatcccaggcgctcgatcccgatc
gcctacgtggccggcatcctcacgctggtggtgctggccgtgggcgtgatggtgttcgcg
ggcggcgcgggcgactggaccaagctcgccaacatcaacgatccgctgccgcaggcgatg
aaatacatcgtcggcgagcacagcggctggatgcacatgctggtctggctcggcctgttc
ggcctggtcgcgtcgtttcacggcatcatcctcggctattcgcgccagatcttcgcgctg
gcgcgcgagggctacctgcccgaatggctcgccaaggtccacccgcgctttcgcaccccg
tatcgcgcgatcctggcgggcggcgtggtcggcatcgcggcgatctacagcgacgagctg
atccagttcggcggccagaccctgaccgcgaacatcgtgacgatgtcggtgttcggcgct
atcgtgatgtatatcgtcagcatggccgcgctgttcaagctgcgccgcagccagccggcg
atggcgcggccgttccgtgcgccgctctatccgctgtttccggcgttcgcgctggccgcc
gcgctggtgtgcctggccaccatggtctatttcaacgcgctggtcgcgctggtgttcctg
gtgttcgtcgcgctcggctacggctacttcatcgcgacgcgctcgcagcgcgcggccgcg
ccggccgaggcgctgctcaaggaatga

DBGET integrated database retrieval system