KEGG   Burkholderia glumae BGR1: bglu_1g00960Help
Entry
bglu_1g00960      CDS       T00905                                 

Definition
(GenBank) HTH-type transcriptional regulator eutR
  KO
K04033  
AraC family transcriptional regulator, ethanolamine operon transcriptional activator
Organism
bgl  Burkholderia glumae BGR1
Brite
Transcription factors [BR:bgl03000]
 Prokaryotic Type
  Helix-turn-helix
   AraC family
    bglu_1g00960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:105022..106083
Genome map
AA seq 353 aa AA seqDB search
MNAASGASRAPGGGAVPEAEDTAEDTRRAAGGADAPAGRAVVSVAHDADEQARNLVGWRQ
TYDQLAAGRFVGTLTELPLDTMKLFRETTSHTLRQACEVRGDAYWFGIPAVPDGGARIDA
QPIAADGFACRPGNLGFELLTPAAFSIYGVVVRGDVLRRYAEQVEHAGLDDRLPRQPMIH
VGAERLARLRALLAASLDGAAGPRAALSGCERHALQAAVLAALFDICAGPDAARQAAPDA
IAPARRRRIVAQARDYVLAHRGRAVGVPELCEQLHVSRRTLQNCFQDVLGMAPATYLRAV
RLNGARRDLCGRAAGSVQDVAAAWGFWHLSQFANDYRRMFGMRPSEALRDSAG
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcagcgagcggagcgagccgggcgccgggcggcggcgccgtgccggaagccgaa
gacacggccgaagacacgcggcgcgccgccggcggcgccgacgcgccggccggacgcgcg
gtggtcagcgtcgcgcacgacgccgacgagcaggcgcgcaacctggtgggctggcgccag
acctacgatcagctcgcggccgggcgcttcgtcggcacgctgaccgaactgccgctcgac
accatgaagctgtttcgcgaaaccaccagccatacgctgcggcaggcctgcgaagtgcgc
ggcgacgcttactggttcggcattcccgcggtgccggacggcggtgcgcggatcgatgcg
cagccgatcgcggccgacggcttcgcctgccggccgggcaacctcgggttcgaactgctg
acgccggccgcgttctcgatctacggcgtggtggtgcgcggcgacgtgctgcgccgctat
gccgagcaggtcgagcacgccggcctggacgaccggctgccgcgccagccgatgatccat
gtgggcgcggagcggctcgcgcggctgcgtgcgctgctggccgcctcgctggacggcgcg
gccggcccgcgcgcggcgctgtccggctgcgagcggcacgccctgcaggcggccgtgctg
gcggcgctgttcgacatctgcgcggggccggacgcggcgcggcaggcggccccggacgcg
atcgcgccggcgcggcggcgccgcatcgtcgcgcaggcgcgcgactacgtgctcgcgcat
cgcggccgcgcggtgggcgtgccggaactctgcgagcagctgcacgtgagccgccgcacg
ctgcagaactgctttcaggacgtgctcgggatggcgcccgccacctacctgcgcgccgtg
cggctgaacggagcgcggcgcgacctgtgcggccgcgcggccggctcggtgcaggacgtg
gccgccgcctggggattctggcacctgagccagttcgcgaacgactaccggcgcatgttc
gggatgcggccgtccgaggcgctgcgcgattcggcgggttga

DBGET integrated database retrieval system