KEGG   Burkholderia glumae BGR1: bglu_1g00990Help
Entry
bglu_1g00990      CDS       T00905                                 

Definition
(GenBank) L-serine ammonia-lyase
  KO
K01752  
L-serine dehydratase [EC:4.3.1.17]
Organism
bgl  Burkholderia glumae BGR1
Pathway
Glycine, serine and threonine metabolism
Cysteine and methionine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bgl00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    bglu_1g00990
   00270 Cysteine and methionine metabolism
    bglu_1g00990
Enzymes [BR:bgl01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.17  L-serine ammonia-lyase
     bglu_1g00990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:complement(109537..110925)
Genome map
AA seq 462 aa AA seqDB search
MAVSVFDLFKIGIGPSSSHTVGPMRAALMFVQGLERDELLERTATVKVDLYGSLGATGKG
HGTDRGVMLGLMGDAPDTVDPDTIDARLAEVRDTRKLALLGRHPVPFVLKEQIGFYRQAL
PEHPNAMTLRARDAAGAPLRETTYLSVGGGFVVTAGAPNTKVLSAAEQMPYPFRTSAELL
ALTASTGKSIAQLMWDNERAWHDEAATRAGLLKIWEVMQSCVSRGCGIGNPDAHGTLPGP
FQVKRRAPQLYRTLTGNPELALRDPLSMIDWINLYAIAVNEENAAGGRVVTAPTNGAAGI
IPAVLHYYMRFTPGANEQGVIDFLMTAAAIGILYKLNASISGAEVGCQGEVGVACSMAAG
ALAAVLGGTPRQVENAAEIGMEHNLGLTCDPVGGMVQIPCIERNAMASVKAVNAARMALR
GDGSHYVSLDSVIKTMRETGADMKTKYKETSRGGLAVNIVEC
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggcagtcagcgtgttcgatcttttcaaaatcgggattggcccgtccagctcgcacacg
gtgggaccgatgcgcgccgcgctgatgttcgtccagggcctcgagcgcgacgagctgctc
gagcgcaccgccaccgtgaaggtcgacctgtacggctcgctcggcgcgaccggcaagggc
cacggcaccgaccgcggcgtgatgctgggactgatgggcgacgcgcccgatacggtcgac
cccgacaccatcgacgcgcggctcgccgaggtgcgcgacacgcgcaagctcgcgctgctg
ggccgccatccggtgccgttcgtgctcaaggagcagatcggcttctaccggcaggcgctg
cccgagcatccgaacgcgatgacgctgcgcgcgcgcgacgcggccggcgcgccgctgcgc
gagaccacctacctgtcggtgggcggcggcttcgtggtgacggccggcgcgccgaacacc
aaggtgctgagcgcggccgagcagatgccctacccgtttcgcaccagcgccgagctgctc
gcgctgaccgccagcaccggcaagtcgatcgcgcagctgatgtgggacaacgagcgcgcc
tggcacgacgaggccgccacgcgcgccggcctgctgaagatctgggaggtgatgcagtcg
tgcgtgtcgcgcggctgcgggatcggcaaccccgacgcgcacggcacgctgcccggcccg
ttccaggtcaagcgccgcgcgccgcagctgtatcgcacgctgacgggcaatcccgagctg
gcgctgcgcgacccgctctcgatgatcgactggatcaacctctacgcgatcgccgtgaac
gaggaaaacgccgccggcggccgggtggtgacggcgcccaccaacggcgcggccggcatc
atccccgccgtgctgcactactacatgcgcttcacgcccggcgcgaacgagcagggcgtg
atcgacttcctgatgacggccgccgcgatcggcatcctctacaagctcaacgcgtcgatc
tcgggcgccgaggtgggctgccagggcgaggtgggggtggcctgctcgatggccgccggc
gcgctggccgccgtgctgggcggcacgccgcgccaggtcgagaacgccgccgagatcggc
atggaacacaacctcgggctgacttgcgacccggtgggcgggatggtgcagatcccctgc
atcgagcgcaacgcgatggcctcggtgaaggccgtcaacgccgcgcgcatggcgctgcgc
ggcgacggcagccactacgtgtcgctcgactcggtgatcaagaccatgcgcgagacgggc
gccgacatgaagacgaagtacaaggaaacctcgcgcggcgggctcgcggtgaacatcgtc
gagtgctga

DBGET integrated database retrieval system