KEGG   Burkholderia glumae BGR1: bglu_1g01020Help
Entry
bglu_1g01020      CDS       T00905                                 

Definition
(GenBank) Glycine cleavage system H protein
  KO
K02437  
glycine cleavage system H protein
Organism
bgl  Burkholderia glumae BGR1
Pathway
Glycine, serine and threonine metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bgl00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    bglu_1g01020
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    bglu_1g01020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:complement(115151..115531)
Genome map
AA seq 126 aa AA seqDB search
MSNVPADLKYTDEHEWIRTEADGTLTIGITDHAQTTLGDIVFLELPQVGKHADAGDPVGV
VESVKAASDIYAPVSGEIIAINEDAVDTPESVNQDAYDAWLFKVRLAPGASTGALLDAQA
YKKLID
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacgtcccggccgatctgaagtacaccgacgaacacgagtggatccgcaccgag
gcggacggcacgctgacgatcggcatcaccgatcacgcgcaaaccacgctcggcgacatc
gtcttcctcgaactgccgcaagtcggcaagcacgccgacgcgggcgacccggtgggcgtc
gtcgaatcggtgaaagccgcctcggacatctacgcaccggtgtcgggcgagatcatcgcc
atcaacgaggatgccgtcgacacgccggaatcggtcaaccaggacgcctacgacgcctgg
ctcttcaaggtcaggctcgcgccgggcgccagcaccggcgcgctgctcgacgcccaggcc
tacaagaagctgatcgactaa

DBGET integrated database retrieval system