KEGG   Burkholderia glumae BGR1: bglu_1g01050Help
Entry
bglu_1g01050      CDS       T00905                                 

Definition
(GenBank) Putative lipoprotein
Organism
bgl  Burkholderia glumae BGR1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:complement(117651..118055)
Genome map
AA seq 134 aa AA seqDB search
MQRLIRTAVGAALVASLAACVVTPPPAKRPVPRPRPAQPAPVQPPPPPQPAPPPIGVERM
NDILGRIDSLGRRIDTRVNGGDYPPPQGQALHRRLEVIRQEATDMGAQHGGGLTGDEQRV
LNQELDTAARAIGV
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgcaacggttgatccgcacggccgtcggcgccgccctcgtcgcctcgctggccgcgtgc
gtcgtcacgccgccgccggcgaagcggccggttccgcgcccgcgccccgctcaaccggcc
cccgtccagccgcctccgccgccgcagccagccccgccgccgatcggcgtcgaacgcatg
aacgacatcctcggccggatcgacagcctcggccgccgcatcgacacgcgcgtcaacggc
ggcgactatcccccgccgcaaggccaggcgctgcatcgccggctcgaagtgatccgccag
gaggcgaccgacatgggcgcgcagcacggcggcggcctgaccggcgacgagcagcgcgtg
ctgaaccaggaactcgacacggccgcgcgcgcgatcggcgtctga

DBGET integrated database retrieval system