KEGG   Burkholderia glumae BGR1: bglu_1g01090Help
Entry
bglu_1g01090      CDS       T00905                                 

Definition
(GenBank) Site-specific recombinase, phage integrase family
Organism
bgl  Burkholderia glumae BGR1
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:complement(123231..124307)
Genome map
AA seq 358 aa AA seqDB search
MSLYKRKTSPNWQYKLYPPGGGAPVQGSTGTSNKEQAQEFHDRLKVELWNQARLGIKPRY
TWNDAVVRYVTEREGLPSLETSKTHLRWLDRHLAGVALADIDRDRIDAIALAKRREPLTV
RTKQGPVAIERTASIGTVRRVVGVLKAVLNAAVEWEWIDRAPVTARAKLPEKRIRWLTLD
QAERLLAELPDHLAEMARFSLETGLRRSNVTGLQWSQVDIVRRVAWIHPDQAKAKKAITV
PLSDTAIAVLLRQRAAKRAPAFVDSVFVYRGTPVYQTSTAAWHKALARCGIREFRWHDLR
HTWASWHVQRGTPLQVLKELGGWETMEMVQRYAHLSADHLAQWVAPLTAAPAPRLAAI
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctctacaaacggaaaaccagtcccaactggcaatacaagctgtacccccctggc
ggcggagcgccagtacagggcagcactggcaccagcaacaaggagcaggcgcaagaattc
catgaccggctgaaggtcgagctgtggaaccaggcgcggctcggcatcaagccgcgttac
acctggaacgatgccgtggtgcgctacgtgaccgagcgcgagggcctgcccagcctcgaa
acctcgaaaacgcacctgcgctggctcgaccggcacctggccggcgtcgcgctggccgac
atcgaccgcgaccggatcgatgcgatcgcgctggcgaagcgtcgcgaaccgctgacggtg
cgcaccaagcaaggccccgtcgcgatcgagcgcacggccagcatcggcacggtgcggcgc
gtggtcggcgtgctcaaggcggtactgaacgcggcggtggagtgggaatggatcgaccgc
gcccccgtcacggcgcgcgccaagctgccggaaaagcggatccgctggctgacgctcgac
caggccgaacggctgctggccgagctacccgaccacctggcggaaatggcgcggttcagt
ctcgagactggtttgcgccgctccaacgtgaccggcctgcaatggtcgcaagtcgacatc
gtgcggcgcgtggcctggatccatcccgaccaggcgaaggcgaagaaggcgatcacggtg
ccgctgtcggacacggccatcgcggtgctgctgcgccagcgcgcggccaagcgggcgccg
gccttcgtcgatagcgtgttcgtctaccgcggcacgccggtctaccagacctcgacggcg
gcctggcacaaggcgctggcgcggtgcgggatccgcgagttccgctggcacgacctgcgc
catacctgggcgagctggcatgtgcagcgcggcacgccgttgcaggtgctgaaggagctg
ggcggctgggagacgatggagatggtgcagcgttacgcccacctgtcggccgatcacctg
gcgcagtgggtcgcaccgctgaccgctgcaccggcgccgcggctggctgcaatctag

DBGET integrated database retrieval system