KEGG   Burkholderia glumae BGR1: bglu_1g01150Help
Entry
bglu_1g01150      CDS       T00905                                 

Definition
(GenBank) Putative phage-encoded membrane protein
Organism
bgl  Burkholderia glumae BGR1
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:complement(128591..128785)
Genome map
AA seq 64 aa AA seqDB search
MKPYVFALGVLLMLAFSTAGMSWLASSALRLVDARHARALALAVSVLCMVALVASLAWSV
PPRG
NT seq 195 nt NT seq  +upstreamnt  +downstreamnt
atgaagccctatgttttcgccctcggcgtgctgctcatgctcgccttctccaccgccggc
atgtcctggctggcatcgagcgcgctgcgcctggtcgacgcgcgccacgctcgcgccctc
gcgctcgccgtgtccgtcctctgcatggtcgccctggtcgcgtcgctggcctggtcggtc
ccgccgcgcgggtga

DBGET integrated database retrieval system