KEGG   Burkholderia glumae BGR1: bglu_1g01280Help
Entry
bglu_1g01280      CDS       T00905                                 

Definition
(GenBank) bacteriophage major tail sheath protein
  KO
K06907  
uncharacterized protein
Organism
bgl  Burkholderia glumae BGR1
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:complement(137083..138255)
Genome map
AA seq 390 aa AA seqDB search
MPQDYHHGVRVIEVTNGGPPIRTVSTAVLGIVCTASDASDTAFPLNTPVLITNVISALGQ
AGTKGTLRKTLDAIGKQTKPVTVVVRVPDGKDEAETTSNVIGTVTADGKYTGAKALLTAQ
AKLGVKPRILVAPGLDTAAVAAALAPIAQSLRAFAYVSANGCKTKEEATAYRKQFGQREI
MVIWPDFIGWDDTTNATAIIPAPAIAAGLRAKIDNDIGWHKTISNVVINGVTGISADVSW
DLQDPATDAGYLNEHEVTTLVNYNGFRFWGSRTCAADSKFVFENYTRSAQVIADSIAEAQ
MGNVDGALNPSLARDIIENINSWFRRQVSNGYLIGGHSWYDPEPNTNDVLSAGQMYLDYD
YTPVPPLENLMLRQYITDRYLATFADRVTA
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgccccaggactaccaccacggcgttcgcgtcatcgaagttaccaacggcgggccgccg
atccgaaccgtgtccaccgccgtgctcggcattgtctgcaccgcgtcggacgcgagcgat
accgcgttcccgctcaacacgccggtgctgatcaccaacgtgatttccgcgctcggccag
gcaggcacgaaaggcacgctgcgcaagacgctcgacgccatcggcaagcagacgaagccg
gttacggtcgtcgtgcgcgtgcccgatggcaaggatgaagccgaaaccacctcgaacgtg
atcggcaccgtcacggcagacggcaaatacacgggcgccaaggccctgctgaccgcccag
gcaaagctgggcgtgaagccgcgcatcctggtcgcgcctggcctcgatacggccgccgta
gccgctgctctcgcgccgatcgcgcaatcgctgcgtgcgttcgcctacgtgtcggcgaac
ggctgcaagaccaaggaggaagccacggcctaccgtaagcagttcggtcaacgcgaaatc
atggtgatctggccggatttcatcggctgggatgacacgacgaacgccaccgcgatcatt
ccggcgccggcgattgcggccggcctgcgcgccaagatcgacaacgacatcgggtggcac
aagacgatttcgaacgtcgtcatcaacggggtgaccggcatttcggccgacgtgtcgtgg
gatctgcaagacccggcgacggacgccggctacctcaacgaacacgaggtgacaacgctg
gtcaactacaacgggttccgcttctgggggtcgcgcacctgcgcggctgattcgaagttc
gtgttcgagaactacacgcgcagcgcgcaggtcatcgccgattcgatcgccgaggcgcaa
atggggaacgtcgacggtgccctcaacccttcgctcgcgcgcgacatcatcgagaacatc
aacagctggttccgccgccaggtttcgaacggctacctgatcggcggccattcctggtac
gacccggagccgaacaccaatgacgttctgtcggccggtcagatgtacctcgactacgac
tacacgccggtgccgccgctcgaaaacctgatgctgcgccagtacatcaccgaccgctac
ctcgcgacgttcgccgatcgcgtgactgcataa

DBGET integrated database retrieval system