KEGG   Burkholderia glumae BGR1: bglu_1g01460Help
Entry
bglu_1g01460      CDS       T00905                                 

Definition
(GenBank) Gp2, phage major capsid protein, P2 family
Organism
bgl  Burkholderia glumae BGR1
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:complement(149267..150280)
Genome map
AA seq 337 aa AA seqDB search
MKKETRQAYRKYATQIAKLNDTDDVSQKFAVEPSVQQTVETKMQESSAFLKSINVLPVTE
LEGEKLGLSVSGPIASRTDTTKAERQPVDPTALDSNRYRCEKTDYDTAITYRKLDAWAKF
PDFQQRIRNVILNQSALDRIMIGWNGVKAALSTDKAANPLLQDVNIGWLQQYRDRASHRV
LHEGAKEAGKVLVGKGGDYVNLDALVMDIVSSMIDPWFQEDTGLVVICGRELLHDKYFPI
VNTTQAPTEQLAADLIVSQKRIGNLPAVRVPFFPKRAMMVTKLENLSIYFQEGARRRSLI
DNPKRDQIENYESSNDAYVVEDFGCGCVSENIELVAA
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaggaaacgcgccaagcgtaccgaaagtacgccacgcaaattgccaagctgaac
gacaccgacgacgtatcgcagaaattcgctgtcgagccgtccgtccagcaaacggtggaa
accaaaatgcaggaatcgagcgcattcctgaagagcatcaacgttctgcccgtgaccgag
ctggaaggcgaaaagctcggcctgtcggtatccggtccgatcgcgagccgcaccgacaca
acgaaggccgaacgtcagccagtcgatccgaccgcgctcgatagcaaccgctaccgctgc
gagaaaaccgactacgacacggccattacgtaccgcaagctcgacgcctgggcaaaattc
cccgacttccaacagcgcatccgcaatgtgatcctcaaccagtccgcgctcgaccggatc
atgatcggctggaacggcgttaaggcagcactgtcgacggacaaagcagcaaacccgctg
ttgcaggacgtgaacatcggttggctgcaacagtatcgcgaccgtgcgtcgcaccgcgtg
ctgcacgaaggcgcgaaggaagccggcaaggtgctcgtcggtaagggcggtgactacgta
aatctcgacgcgctcgtgatggacattgtgtcgtcgatgatcgacccgtggttccaggaa
gatacggggctcgtcgtgatctgcggccgcgagctgctgcacgacaagtatttcccgatc
gtcaacacgacgcaggcaccgaccgagcagctcgcggccgacctgatcgtcagccagaag
cgcatcggcaacctgccggccgtgcgtgtgccgttcttcccgaagcgcgcgatgatggtg
acgaagctggaaaacctgtcgatctacttccaggaaggcgcacgccgtcgctcgctgatc
gacaacccgaagcgcgaccaaatcgagaactacgagtcgtcgaacgacgcgtatgtcgtc
gaagactttggttgcggctgtgtctcggaaaacatcgagctggtggcggcatga

DBGET integrated database retrieval system