KEGG   Burkholderia glumae BGR1: bglu_1g01480Help
Entry
bglu_1g01480      CDS       T00905                                 

Definition
(GenBank) Phage terminase, ATPase subunit
Organism
bgl  Burkholderia glumae BGR1
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:151273..153042
Genome map
AA seq 589 aa AA seqDB search
MLETTDPIQREANVRQIARSLYWQGWRISSIARHLELKPATVASWCRRDKWKDATPIERI
EAAAETRLMVLIAKDKKDGADYKEIDLLGRQIERLARVQKYGETGREGDLNPNIAARNAG
PKRKPPKNEISEEQEERIVKAFRESLFDYQKVWYRNGDQQTRNILKSRQIGATWYFAREA
FVDALDTGRNQIFLSASKAQAHVFKQYIVQFARDVADVELTGDPIILPNGATLYFLGTNS
RTAQSYHGNLYFDEYFWVPKFRELNTVASGMAMHKRWRLTYFSTPSSTTHEAYAFWSGAD
ANRGRAPGDRIQIDTSHEALVRGMLGEDEQWRQVVTVLDAIEGGCDLFDLERLRRRYSAD
AFANLLMCQFIDDSVSVFKLAELQRCMVDSWEEWADDFSPLLLRPFGYREVWVGYDPALT
GDSAGLVVVAPPRVEGGTFRVLERHQFRGNDFEEQAAAIEQITRRYNVGYIAIDTTGMGQ
GVYQLVRKFYPAAVALNYSPEVKTRLVLKGQSVIRNGRLQFDAGWTDLAAAFMGIKQTMT
ASGRHATYTADRNEETGHADLAWACLHAIDREPLAGGDINSSSFTEFYS
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atgctcgaaacgacagatccaattcaacgcgaagcgaacgtgcgacagatcgcgcgttcg
ctctactggcaaggctggcgcatctcttcgatcgcacggcatctcgaactgaaacccgcg
accgtggcatcgtggtgccgtcgcgacaaatggaaagacgcgacgccaatcgagcgcatc
gaggcggcggccgaaacgcgcctgatggtcctgattgcgaaggacaagaaggacggcgcg
gactacaaggaaatcgacttgctcggccggcagatcgagcggctcgcgcgtgtgcagaaa
tacggggagacggggagggaaggcgacctgaacccgaacattgccgcgcgcaatgccggg
ccgaagcgcaagccgccgaaaaacgaaatcagcgaggaacaggaagagcggatcgtgaag
gcgttccgcgaatcgctgttcgactatcagaaggtctggtatcgcaacggcgatcagcag
acgcgcaatatcctgaagtcacgacagataggcgcgacctggtatttcgcacgcgaggcg
ttcgtcgacgcgctcgataccgggcgcaatcagatttttctgtcagctagcaaagcacag
gcgcacgtcttcaaacagtacatcgtgcagttcgcgcgtgacgtggccgacgttgagctg
acgggcgatccgatcattctgccgaacggcgcgacgctgtacttcctggggacgaactcg
cgtaccgcgcagtcgtatcacggcaacctgtatttcgacgaatatttctgggtgccgaag
ttccgcgagctgaataccgttgcgtcgggtatggcgatgcacaaacgctggcggctgacc
tacttcagcacgccgtcgagtacgacccatgaagcctacgcgttctggagcggcgccgat
gcgaatcgtgggcgcgcccctggcgatcgtatccagatcgacacgagccacgaagcgctc
gtgcgcggcatgctgggcgaagacgagcagtggcgtcaagtcgttaccgtactcgatgcg
atcgagggcggctgcgacttgtttgacctggagagacttcggcgccggtacagcgcagat
gcttttgcgaacttgctgatgtgccagttcatcgacgattcggtgtcggtgttcaagctg
gcggagctgcagcgctgcatggtcgactcgtgggaggaatgggcggacgatttctcgccg
ctgctgctgcgcccgttcggttatcgcgaggtgtgggttggctacgatccggcactgact
ggcgattcggccggtctggtcgtcgtggcaccgccgcgtgtcgagggtgggacgttccgc
gtgctcgaacgtcaccagttccgcggcaacgacttcgaggagcaggccgcggcgatcgag
cagatcacgcggcgctacaacgttggctacatcgcgatcgacacgacgggcatggggcag
ggcgtctatcagctcgtgcgcaaattctacccggcggccgttgcgttgaactactcgccc
gaagtgaaaacccgcctcgtgctgaaggggcaatccgtcatccgcaatggccgcctgcaa
ttcgacgccggatggaccgacctggccgcagcgttcatgggaattaaacaaaccatgacg
gcgagcggccgccacgcaacgtacaccgccgaccgtaacgaagagacgggccacgccgac
ctggcgtgggcctgcctgcacgcgatcgatcgcgaaccgctcgccggcggcgacatcaat
tcttcatctttcacggagttctattcatga

DBGET integrated database retrieval system