KEGG   Burkholderia glumae BGR1: bglu_1g01560Help
Entry
bglu_1g01560      CDS       T00905                                 

Definition
(GenBank) Hypothetical protein
Organism
bgl  Burkholderia glumae BGR1
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:complement(162531..163100)
Genome map
AA seq 189 aa AA seqDB search
MRPRACPGTSRGWPRRPAPARRHARPGAGGTRPGAAQAARPRRAAGPARLIQSDTSAGGF
TTLPRSADNACLPSSRRIDMVNDMRAVVIRAPIRELRGLPTWKLIPFASIAGGPHGARTY
CVSKQGVVITLDETTPGITQTLNVIPHDQNDDRAAASHALRDLARELDAAGFDRQLTASA
DTPGPLGNA
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
gtgcggccgcgtgcttgccctggaacgtcgcgcggatggccgcgccggccggcacccgcg
cggcgacacgcgcgaccgggtgccggcggcacgcgccccggagcagcgcaggcggcacgg
ccacggcgcgcagcaggcccggcgcgcttgatccagtcggatacgagcgcgggcggtttc
actacactgccccgatcggccgacaacgcctgcctaccgtcatcgaggaggatcgacatg
gtgaacgacatgcgcgcggtggtgattcgtgcaccgatccgcgagctgcgcggcttgccc
acctggaagctgattccattcgccagcatcgcgggcggcccgcacggtgcacgcacctac
tgcgtcagcaagcaaggcgtggtgatcacgctcgacgagaccacgcccggcatcacgcag
accctgaacgtgatcccgcacgaccagaacgacgatcgcgccgccgcgagccatgcgctg
cgcgatctcgcccgcgaactcgacgcagccggcttcgaccgccagttgaccgcctcggcc
gacacgcccgggccgctcggtaacgcatga

DBGET integrated database retrieval system