KEGG   Burkholderia glumae BGR1: bglu_1g01580Help
Entry
bglu_1g01580      CDS       T00905                                 

Definition
(GenBank) Transcriptional regulator, LysR family
Organism
bgl  Burkholderia glumae BGR1
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:164379..165320
Genome map
AA seq 313 aa AA seqDB search
MNAMNIADVDLNLLKVFEVLFDEGGASRAAIRLDLTQSAVSAALRRLRALYGDPLFVRTG
RGLAPTARARELKPLIGEALDRCRQSLAFGAPAPASFEGRAVSVAMSDDFEIAFGGRLIE
CAARLAPGLRVIFRQTHSQIVGDALANREVDLAIAAGGFATRGLGHMALGHGRYACLVDP
AAAPGRLVLTLDDFLAREHVLVSSGGVVGIVDEALAEIGRRRTVRASTTHFAALPFLLRG
TPAVATIPHHAAEALARMTGLGLVACPLAMPAYPVALGWRVSTLRDAAVAKLRQAIVDSF
AGFAAASLAGGRP
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgaatgccatgaatatcgccgatgtcgacctgaacctgctgaaagtgttcgaagtgctg
ttcgacgagggcggcgcgagtcgcgcggcgatccggctcgacctcacgcagtccgccgtc
agcgccgcactgcggcgcctgcgcgcgctctacggcgatccgctgttcgtgcgcaccggc
cgcggcctcgcgcccaccgcgcgtgcgcgcgaactgaagccgctgatcggcgaggcgctc
gaccgctgccgacagagcctcgcgttcggcgcgcccgcgccggcctcgttcgaggggcgt
gcggtgtcggtcgcgatgtcggacgatttcgagatcgcgttcggcggtcgcctcatcgaa
tgcgccgctcggctcgcgccgggcctgcgcgtgatcttccggcagacgcacagccagatc
gtcggcgacgcgctcgcgaaccgcgaggtcgatctggcgatcgcggcgggcggcttcgcc
acacgcgggctcggccacatggcgctcggccacgggcgctatgcatgcctcgtcgatccg
gccgccgcgccgggccggctcgtgctgacgctcgacgatttcctggcgcgcgagcatgtg
ctggtgtcgtcgggcggcgtggtcgggatcgtcgacgaggcgctcgccgagatcgggcgc
cgccgcacggtgcgcgcgtccaccacgcacttcgccgcgctgccgttcctgctgcgcggc
acgccggccgtggcgacgatcccgcatcacgctgccgaggcgctcgcgcgcatgacgggg
ctcgggctcgtcgcctgtccgctcgcgatgccggcctacccggtcgcgctcggctggcgc
gtcagtacgctgcgcgacgcggccgtggcgaagctgcggcaggcgatcgtggacagcttc
gccgggtttgcggcggccagcttggccggcggccggccgtag

DBGET integrated database retrieval system